SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015886 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015886
Domain Number 1 Region: 110-218
Classification Level Classification E-value
Superfamily Second domain of FERM 6.15e-28
Family Second domain of FERM 0.0032
Further Details:      
 
Domain Number 2 Region: 223-361
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-24
Family Third domain of FERM 0.0027
Further Details:      
 
Domain Number 3 Region: 15-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.51e-17
Family First domain of FERM 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015886   Gene: ENSGACG00000012008   Transcript: ENSGACT00000015917
Sequence length 602
Comment pep:known_by_projection group:BROADS1:groupXV:11828039:11836830:1 gene:ENSGACG00000012008 transcript:ENSGACT00000015917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRLHFHNNKTMQDRRCVCVFLPNDDTLDVIVNVKTLCQELLVQVCDLLRLKDCHLFGLS
VIQNNEHIYMELDQKISKYCPKEWKREASKGIDQFGPPMIIHFRAQYYVENGRLISDRAA
RYYYYWHLRKQVLLSQCIQREEAYFLLAAFALQADLGNFKRNKHFGKYFEPEAYFPSWVI
TKRGREYILRHIPNMHKDQFALTASEAHLKYIKECAHLDDVTVHYYRLYKDKKEVEASLT
LGLTLRGIQIFQNVGSVRQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLIYYTGCPL
RSRHLLQLLSNSHRLYMNLQPVLKQVRRLEENEDKKQYRESYISDALELDMDQLDKRSRA
SGSSAGSMSHHKRLSRHSTTSHGSSHTSGIEADSFRASGQAPHRPLRTCSSSTTSHGSSH
TSGIESSGKERMLDDDEIEMLVDDPKDYEELHEMVLDQELCIHITEDMLTMSPDPTNGYS
GLIVKDVGSSTSSSSETVIKMRGQSIESLPQTSACRKPQSSTDRHSQSLDDVRLYQKDCL
HWAELCQDTAHSYTFGCAQELCQGLADQRAGMLGEQHPFPIKRTNKYFSLDLSGEEVPEF
VV
Download sequence
Identical sequences G3PE62
ENSGACP00000015886 69293.ENSGACP00000015886 ENSGACP00000015886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]