SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015929 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015929
Domain Number 1 Region: 188-294
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-30
Family Pleckstrin-homology domain (PH domain) 0.0000229
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily PH domain-like 8.05e-22
Family Pleckstrin-homology domain (PH domain) 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015929   Gene: ENSGACG00000012025   Transcript: ENSGACT00000015960
Sequence length 383
Comment pep:novel group:BROADS1:groupXV:11883626:11892187:1 gene:ENSGACG00000012025 transcript:ENSGACT00000015960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYVDRQNRICGFLDIEENEGSGKFLRRYFILDTQQGSLLWFMDNPQNLPKCAEKVGSLK
LSYISMVSDATKLRPKAEFCFVINAGMRKFYLQANDQQDLVDWISVLNNATKITVPKSGE
GQTPAHTETPQEVLGAVKPVSYKTEIIGGVPITTTMQVTRCSRSRHEGQNEAERSALKRG
QNPYFLSGGAQDHGAIKAGYCVKQGALMKNWKRRYFLLEENALSYYKSDLEREALRVIPL
KEIHKVQECKHSELKMRDNLFEMASSSRTFYIQANSPEDMHSWIKAISGAIVAQRGPGRS
AYTIRQARRLSSPCLPRNAVLPQCPPPSSITLTRNYTHNPAPPQRALSCTLDRQQQENFL
GLLPWRLSGVPAARSRLSLLSPK
Download sequence
Identical sequences G3PEA5
ENSGACP00000015929 ENSGACP00000015929 69293.ENSGACP00000015929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]