SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015982 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015982
Domain Number 1 Region: 152-341
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-61
Family Phosphotyrosine-binding domain (PTB) 0.0000000254
Further Details:      
 
Domain Number 2 Region: 512-610
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-26
Family SH2 domain 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015982   Gene: ENSGACG00000012077   Transcript: ENSGACT00000016013
Sequence length 617
Comment pep:known_by_projection group:BROADS1:groupXX:13198875:13205549:1 gene:ENSGACG00000012077 transcript:ENSGACT00000016013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVPKTKYTHFRSESLSSTDETNSDPSPLPPSSPATPLTPSPGLPPSLSSSSLAPILPP
SSPRQAENSPTTLCSFFPRMGSLRLGVSATLLPGGDRSSSGSSPPLHRPTAPLTAPSPPP
RPTLQDMNRLGGASRKARSEGAARKARVEGGQLGGDEWTRHGSFVNKPTRGWLHSDGVVT
TAGVSYSVRYMGCVEVLQSMRALDFNTRTQVTREAISVVCEAVPGAKGAQRRRKPSSRCM
TSILGKSNLQFAGMTISLTISTSSLNLLASDCKQIIANHHMQSISFASGGDPDTAEYVAY
VAKDPVNQRACHILECSEGLAQEVISTIGQAFELRFKQYLKNPPKLVTPHDRMAPFDGSA
WEEEEEDDNAAAAAAPPPDVPYYNNFPGKQPPPGGLVDMRSRPGATLPREAALMSNATFA
QKGCRLAELLPYGQPGQNDIHKQPLPPLPVGAKEGGRELFDDPSYVNVDKPRHPVAANGN
AHRDAFDMKPFDDALGVSGPGGASSSTAAPPPLVQQLQCEAWFHGSLSRREAERLLTRDG
DFLVRESGTTAGQYVLTGQQGGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNSLPI
VSAGSEVCLQQPVERRA
Download sequence
Identical sequences G3PEF8
69293.ENSGACP00000015982 ENSGACP00000015982 ENSGACP00000015982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]