SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016039 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016039
Domain Number 1 Region: 585-709
Classification Level Classification E-value
Superfamily PH domain-like 0.000000088
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016039
Domain Number - Region: 945-1036
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00183
Family Regulator of chromosome condensation RCC1 0.08
Further Details:      
 
Domain Number - Region: 220-326
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0798
Family Regulator of chromosome condensation RCC1 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016039   Gene: ENSGACG00000012103   Transcript: ENSGACT00000016070
Sequence length 1123
Comment pep:known_by_projection group:BROADS1:groupXI:11213063:11221611:1 gene:ENSGACG00000012103 transcript:ENSGACT00000016070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPITLLWAVDVYGRVYSLSTAGQRWVRADDTLLELKRVTAGKDRCWGIGCDHHVYLNMMP
SETSIRYREETYENQRWNPVDSFTDTLLPTDRWPWSDVTGMNPQPLHSFQLPSRSWDWEG
DWYVDQSCGEPSQTGGWEYAVDFPANFSPDKKWNSCVRRRRWIRYRRYTAQGTWAKIPLD
SPRKPLLPLCDISCGGWQMSDQSGRYPYLWGVSQQGEVWFREGIHPRVPEGSGWEEVEVL
KEVAQLSAGPGDLLWALLWDGNLLVRTGLSLDCPTGTSWVELESPGKEIEALHVAVGVSV
VWVVTKDYKVWFRRGVNSHNPCGSGWISIGGEMMVVDVGLNEQVWAVGEDRGLYFRMGVT
PSEPSGSGWIPVSAQKECELGDRRAEASKSSLLSCTDSDSDLGGNDSPPPKTGDPPPAVH
QDAPRPFIPASDSFINSLVSDRDKTAAPQVPVTEAPREGVQELSPAPILPTPETTGHDVP
WMNVDLEARCAQAAGLSPGAAGTLETSRGVGEEDAPVWSWISGGGCDVDASSQISWLSPT
GPLSSSLSLTPVQSAAWSEQPQQQQQESRAPERIASALCSHPFPPPQSVWVRKGALRWWR
DWKPQRWVDVAVALEQSTKSDGRKDSIFFVYYTQYDEKKYLHVFIHEVTALVPVLMDCHY
AFAVYTTQRTQQRWPLVLAAQTQTDMKDWLSLLSDCCCECRGIDGPPSRQALWSTTSTGE
IMVHEPSFSLEAAAHTLACDLMFWRQVPGHLRCVESNSLGLVWGIGWDGTAWVYSGRCGQ
QPIPGDAAERHQQSDVRSVHVYENQRWNPMTGYTGASRGLPTDRPMWSDEGGLQERTRGN
THPPSPQWSWASEWAVDYDVPGGTDQEGWQYAADFPTTFHGHKAMKDFVRRRRWTRKCTI
TLTGPWQRVPPIRLSDISLMPCLAHSSMEQVPVWALSDKGDVLCRLGVTPQNAAGSSWLH
VGTDQPFKSISIGGANQVWAIAKDGEVFYRGSVSPQNPAGECWYHIPCPPRQTLRQLSVG
RTSVFAVDDNSNLWFRQGLTPSYPQGSAWELISNNVTKVSVGPLDQVWIIAEGVPGFPAE
TPGAVCHRLGVGPMQPRGQSWDYGIGGGWEHISVRGNSAEAPR
Download sequence
Identical sequences G3PEL5
ENSGACP00000016039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]