SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016042 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016042
Domain Number 1 Region: 45-79
Classification Level Classification E-value
Superfamily WW domain 0.0000000428
Family WW domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016042   Gene: ENSGACG00000012123   Transcript: ENSGACT00000016073
Sequence length 244
Comment pep:known_by_projection group:BROADS1:groupXII:15904368:15906024:1 gene:ENSGACG00000012123 transcript:ENSGACT00000016073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPAALLARLAKRGIVKPSDQEADEEIIAEDYDDNNVDYEATRVESLPPNWYKVFDPAC
GLPYYWNVETDLVAWLSPNDATSVVTKPAKKIREIRVCLVLFCDHCLLFYFHDSAEGGDE
RIERPFEKLEREREREREKERERERERERERDEGRERERRKPRREEPAPYSKNKRGRKDD
EMDPMDPSAYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAANQ
IPKE
Download sequence
Identical sequences G3PEL8
ENSGACP00000016042 ENSGACP00000016042 69293.ENSGACP00000016042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]