SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016062 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016062
Domain Number 1 Region: 172-211
Classification Level Classification E-value
Superfamily WW domain 0.000000000000974
Family WW domain 0.00073
Further Details:      
 
Domain Number 2 Region: 112-152
Classification Level Classification E-value
Superfamily WW domain 0.0000000275
Family WW domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016062   Gene: ENSGACG00000012139   Transcript: ENSGACT00000016093
Sequence length 443
Comment pep:known_by_projection group:BROADS1:groupI:14774869:14796093:-1 gene:ENSGACG00000012139 transcript:ENSGACT00000016093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPVGHQIVHVRGDSETDLEALFNAVMNPKNTIVPPSVPMRMRKLPDSFFKPPEPKSHSRQ
ASTDAGTGGVLTPHHVRAHSSPASLQLGAVTGGSMSGMPPPSPQHLRQSSYEIPDDVPLP
PGWEMAKTASGQRYFLKAILIRTTAWQDPRKALLQMNQAPPPSTGPVQQQNIMNPASGPL
PEAWEQAITSDGEIYYINHKNKTTSWLDPRLDPRFALNQQRISQSAPVKQGGQLPPGFAV
GNSQMRLQQMEKERLRQKQQELLRQRPQVRNREEKSRKKWKELSIRNQLPTSMDQDGGTN
PVSSPMAQDARTMTANSTDPFLNSYVSSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV
DEMDTGDALPPSMATQPSRFPDYLDAIPGTDVDLGTLESESMAVEGEELMPSLQEALSSD
ILNDMESVLAATKIDKESFLTWL
Download sequence
Identical sequences G3PEN8
69293.ENSGACP00000016062 ENSGACP00000016062 ENSGACP00000016062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]