SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016083 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016083
Domain Number 1 Region: 714-901
Classification Level Classification E-value
Superfamily Sec7 domain 4.84e-64
Family Sec7 domain 0.00000623
Further Details:      
 
Domain Number 2 Region: 917-1048
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016083   Gene: ENSGACG00000012157   Transcript: ENSGACT00000016114
Sequence length 1426
Comment pep:known_by_projection group:BROADS1:groupXII:15946983:15968171:1 gene:ENSGACG00000012157 transcript:ENSGACT00000016114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRRDRAPAMETSPESPNRAVEYLLELNNIIESQAKLLETQRRRIEELEGQLDRVNQENQD
LRHDCSPRTPGSDNPEQNHNHSQPPSVPVHHGGHPAKRSCFHPSDRETPFPPHNGSDAHK
KIRHRRRGIRLASKEETEGRCGREERVEHTHTYTHLPSVNKGERGERGEPGPEKARLREL
PLFFVRPPSTSGQPTSAPSTPTAARALPAFPTSLTVHGFASLHHVDGDAQCTETATHKDI
QTPFSQKPYLRGSERYTDSRTSSAPAGSRAPPCVSAPSSASLAWALRTRHQPASLALRKQ
EEEENKRCKALSDSYELSTDLQDKKVEMLERKYGGSFVSRRAARTIQTAFRQYRMNKNFE
RLRTSASESRMTRRIILSNMRLQYSFDERQPQQQAQTQTNFTHTVAIGPPHSPDPDRPGD
YTHLEDSFSKQVKSLADSIDDALTCRAGRDDSQEGSREGGGIRGGLSMHGDSTATSYSDV
TLYMDDGMPTSPLSLDRAPSSTDTEYWGPGGGVGGREDSRDTEGGGSSNSRRSTPCTECR
DYRLRGAHLPLLTIEPPSDSSVDTSDRSDRGSLTRQLVYEQEPGVGACSPQGTLKNSPST
GTRPSSTAAAQGQTRAPARPMPTHIPHQPPTTPLSSSSSTALPPGGLEQPCCSDGDNDSL
NSTTNSNETVNCSSGSSSQDSLREPLPPLGKQTYQRESRHSWDSPPFNSDVVQRRQYRIG
LNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLD
CVVDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLIEAFSQRYCVCNPILIRQFQNPDT
IFILAFAIILLNTDMYSPNVKAERKMKLEDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWE
LRTNDDHVSQVQAVERVIVGKKPVLSLPHRRLVCCCQLYEVPDPNRPQRTGVHQREVFLF
NDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYPHGIRLTSAVLGGERKVLII
FMAPSQQDRTRFVSDLRESIAEVQEMEKYRVESELEKQKGVMRPSLLTGSVVGGMGVKSD
VVNGTLGRTSFDDNCSMGEGLKRTALSSSLRDLSDAGKRGRRNSVGSLDSTMEGSIISSP
QPHQRYPLPGVGPGGSSSSNNNSGSFLGSLFGSKRAKPPGPLIPPGPPYPAPVPPPTTGG
PPPHSPSSLCQLDGGPSKIQALHAQYCHVGTVQPPPPYYHHHRYHVQTVPPPLQGVPPHS
IQRGPLPCRLPLGAPHPTHSIRGGGVPGPKLPLSMSHSHPHPHAHSQTHPGHVHTPHPAS
HSTHQTHFIFGTLPHNLPSASVNAHHAASAGPYLPQYPPLSSIPPPPPHSPLPPPSSPLT
PLTPLSPLPPQHPGQPQQGPQVTGAGATGTGGSSKSKPINRISTVV
Download sequence
Identical sequences G3PEQ9
ENSGACP00000016083 ENSGACP00000016083 69293.ENSGACP00000016083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]