SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016097 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016097
Domain Number 1 Region: 294-473
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00000205
Further Details:      
 
Domain Number 2 Region: 2-186
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.21e-49
Family BAR domain 0.0041
Further Details:      
 
Domain Number 3 Region: 159-267
Classification Level Classification E-value
Superfamily PH domain-like 9.62e-17
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016097   Gene: ENSGACG00000012165   Transcript: ENSGACT00000016128
Sequence length 697
Comment pep:known_by_projection group:BROADS1:groupI:14826603:14842621:-1 gene:ENSGACG00000012165 transcript:ENSGACT00000016128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQNADDVLITPLEKFRKEQIGAAKEGKKKFDKETEKYYSTLERHLSLSSKKKEAYLQEAD
TQIDKERQLFYDASLEYVFKIQEVQEKKKFEFVEPLLAFLQGLFTFYHEGYELAHEFEPY
KQQLQFNLQNTRNNFVSTKQEVEKLMKRIRSADQDYKPPGQWTMEGFLYVQEKRGPLGCT
WTRHYCTYEKGGKTFSMSSAETKATAKQNGLVLNQPEMFKLKSCIRRKTDSIDKRFCFDI
EVVERHGVMTLQALSEPNRRLWLEAMDGKEPIYNLPAILNKKEETFLNEAGFNFVRKCID
LVEIRGINTMGLYRIGGVNSKVQKLLTTVFSSRAPVDIDLDPDTWDNKTITSGLKTYLRC
LSEPLMTFKLHKDFILAVKSDDQNYRVCAVHALVHKLPDRNKEMLELLIKHLVTVSTQSQ
SNLMTVSNLGVIFGPTLMRSQEETVAAMMNIKFQNIVMEILIENFSKIFHQPPDPNVPLP
QPQSQPGSRRSRAICLSTGPRKPRSLYTPALCLADAESDTFSSSPSSTPPGSMESLVSHS
SQQKSSSQTGSPRSRTKGCPELRAKPARLPPVGVAWVSSPESSSREDAGRTDGESEDALS
LSSPSTPPGMSLAPKKAPHRHMDLRPASLIRSAGPSLLSLHIPEGHRSCSGSVQSLSTLE
PDEGLKPSQHPDLPPKRGTRCREDASVSNGYQRPGSV
Download sequence
Identical sequences G3PES3
69293.ENSGACP00000016097 ENSGACP00000016097 ENSGACP00000016097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]