SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016140 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016140
Domain Number 1 Region: 318-446
Classification Level Classification E-value
Superfamily Plus3-like 8.24e-45
Family Plus3 0.000000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016140   Gene: ENSGACG00000012195   Transcript: ENSGACT00000016171
Sequence length 677
Comment pep:known_by_projection group:BROADS1:groupXV:12166370:12172740:1 gene:ENSGACG00000012195 transcript:ENSGACT00000016171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKKRKGRVVIDSDSEDSASDDNLDQELLSLAKRKRVDSGDQEEPVSKPAASSDSETSDSD
DEWTVGGTKGKKKVKPAKGSEKKNATKKKVNKATASGSSDGGSSAESSAPEEGEVSDSES
NSSSSSSDSDSSEDEVFRDGYDDDLMGDAEDRARLEQMTEKEREQELFNRIEKREVLKRR
FEIKKKLKTAKKKEKEEKKKKQEEEQEKRKLSQVQDTQVVMSHNKERRSKRDEKLDKKSQ
AMEELKAEREKKKNKTAAELLAKRQPLKTSEVYSDDEEEEEEDDDKSSVKSDRSSRSSSY
DDDDKEETPPKSQPVSLPDELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNSSSKP
VYRVAEIVDVVETAKVYQLGTTRTNKGLQLRHGGDTRVFRLEFVSNQEFMENEFMKWKEA
MIVAGMQVPTLDEITKKEQSIKEAVNYKFNDKDIEDIVKEKDRFRKAPPNYAMKKTQLLK
DKAMAEETGDSDKVKGIQVELNELEERAEALDRQRTKSISAISYINQRNRSWNIVESEKA
LVAEGQNAKNQQMDPFTRRQCKPTMVSNARDPSVHAAILAHLNQKYGSGSDAAPDAAGSD
SNKLGQLNSKDKDGPKPNTDLSEDLFKVHDFDVKIDLQVPNAEAKSLSVSSNALPVKDGA
PRRSLNLEDYKKRRGLI
Download sequence
Identical sequences G3PEW6
69293.ENSGACP00000016140 ENSGACP00000016140 ENSGACP00000016140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]