SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016170 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016170
Domain Number 1 Region: 12-49
Classification Level Classification E-value
Superfamily WW domain 0.0000000000195
Family WW domain 0.0013
Further Details:      
 
Domain Number 2 Region: 56-90
Classification Level Classification E-value
Superfamily WW domain 0.00000000103
Family WW domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016170
Domain Number - Region: 117-133
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0491
Family Tyrosine-dependent oxidoreductases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016170   Gene: ENSGACG00000012221   Transcript: ENSGACT00000016201
Sequence length 140
Comment pep:novel group:BROADS1:groupXIX:15481309:15483236:1 gene:ENSGACG00000012221 transcript:ENSGACT00000016201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALKFAGMDDTDSEDELPPGWEERSTKDGWVYYASHDEMKTQWEHPKTGKKKRCAGDLP
YGWEQETDEKGQMIYVDHINKRTTYFDPRQAFTVEDVVLKPKRYDGNTAALEILQGRDFS
DKVVLITGGNSGIDNDSKRE
Download sequence
Identical sequences G3PEZ6
69293.ENSGACP00000016170 ENSGACP00000016170 ENSGACP00000016170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]