SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016234 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016234
Domain Number 1 Region: 132-240
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.67e-25
Family DEP domain 0.0000825
Further Details:      
 
Domain Number 2 Region: 247-356
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-25
Family Pleckstrin-homology domain (PH domain) 0.0000301
Further Details:      
 
Domain Number 3 Region: 9-117
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-24
Family Pleckstrin-homology domain (PH domain) 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016234   Gene: ENSGACG00000012268   Transcript: ENSGACT00000016266
Sequence length 358
Comment pep:known_by_projection group:BROADS1:groupXV:12220715:12224923:1 gene:ENSGACG00000012268 transcript:ENSGACT00000016266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTDDKNTPLREGFLVKRGHLVHNWKARWFVLMSDKLLYYKYEGGKRDSCQRGKILLKDC
VITCPFLEYENRPLVFKLLTKNGVDHFLEACSREERDDWADDITAAVAKLQPSEGGEVTK
QQHPAGSQLHDINLSKVLDCMYDVHSGINMSNHMEQGSTYSNCFSGSAVVDWLVFMQLVL
TRVEAMTLASALLEEGFLRPIGLKSAEALRTAGLSEQFMDDSTALYSFSDSLKKRGSVKA
ESSASAVELSGKVVKRGYLLKQGHRRKNWKVRLFVLRSQPSYLHYYDPTKDDISPAGGFS
LRSCLVSSLGDNGVPSGVKGNIQGNLFKIITQSDTHYFMQAPTEQQKMDWIDAIRKQT
Download sequence
Identical sequences G3PF60
ENSGACP00000016234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]