SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016255 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016255
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.58e-32
Family Ubiquitin-related 0.00000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016255   Gene: ENSGACG00000012291   Transcript: ENSGACT00000016287
Sequence length 95
Comment pep:known_by_projection group:BROADS1:groupXI:11370192:11373786:1 gene:ENSGACG00000012291 transcript:ENSGACT00000016287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEKPKESVKTENNEHINLKVAGQDGSIVQFKIKRHTPLIKLMKAYCDRQGLSMRQIRF
RFDGQPINETDTPSQLEMEDEDTIDVFQQQTGGLI
Download sequence
Identical sequences G3PF81
ENSGACP00000016255 69293.ENSGACP00000016255 ENSGACP00000016255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]