SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016270 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016270
Domain Number 1 Region: 1793-1858
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.01e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016270
Domain Number - Region: 1162-1269
Classification Level Classification E-value
Superfamily Ras GEF 0.0126
Family Ras GEF 0.052
Further Details:      
 
Domain Number - Region: 1970-2022
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 0.0471
Family Transducin (alpha subunit), insertion domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016270   Gene: ENSGACG00000012287   Transcript: ENSGACT00000016302
Sequence length 2541
Comment pep:known_by_projection group:BROADS1:groupXV:12232184:12252104:1 gene:ENSGACG00000012287 transcript:ENSGACT00000016302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPFGREAETFLQDLFEYFKRCLRYGEWELANACVPQLVRSTGGLSEKLRNIIKAIIFHP
YKLQWESVGSPHKLAWFWLQVLEKWTEEQVPLDVRRELEFLLLLEELGSESIADNVLKEL
HQAFLETQSTEGSRRTDPAVESCLRTLLEKKKPRLAQTLTHFLQDESCTEDHTLEHTFIQ
HLIKALAKPERTPEKVEESDGQLEALCEALWAARNKPLKEERILSSLLRPRCDALVTVYC
SAALRLQRDHLLRSAPDTQGRPMDLPEAEKLALSLCCHKDRPSIWKTIYFECLSSGKHFL
EQVLVTALDLIKHEEFSQLKDLVRLEFQPLSRLLLLLRWTECRSLSSAQMLLSILHQHQP
PANDSVLQEFSDLLSSQLGILEWCKNNNPEISMDALLAQLHTLDNHSALYILHSLTPLAQ
FEEHKILALLQQLPNPAGTEDAEVSSGVQRNIVLFQGFCAIKYAVYALCVNAHKYSKCTE
CEPMKQQQHLPSEADMEKNTTSSEGCHLAFQHYLSECQLYLEAVPAMFRLELLEDIFSLL
FLSTADFSLQIPKEEELLLDARNTSEGSGTEAQTDETEYCRKENWKLRSSSPSAAHPSHL
ELGHFIRGCRGFLSDVTAMMGFLKLLKEGLEGMRVLGHEGQEAGRALLREAEAAGNLGCS
VTAETFGPRLQRLSKRTAEAQWRLQIITSNQSSGSASENPPRMTAVSSPVTTLGRSKSSS
LRRRKRPGRHAAERQTSVEKHSGEVSTSASDGGGGTGCVELEVCPCGGPHTWLVPAMLSP
PESLLMSCVRQGNFMEAHQVSLVFDLQLSASFGELVFMERYKEVLVELGRVEQKMQSQSR
TSSSSSSEGLAPAAVPVAGRSRLGSSGLSTLQAIGSAAAAGVAFYSISDIADRLLSTPSH
PMPSLEDGYWLSRCTSDPPGLLHTLLQELSPAAMAAFDLACCHCQLWKTSRQLLDTAERR
LGSSLEARGVRVDPKVPHSEGICGFPMILQQISKILNHSSTKSSVKTEAVGDDQAPISPF
QQPFGCCIQEVLLCCYPTLSEESIAARLGLCQRLEATLHVLSTATDATGPLSKQLVEQAS
LKQSELETHPVRSSMKQLLRSLDQLCPFEPDGELARPDYARSFLDYVNTLASVLVRSLGS
EDQSGDVKLGNPLLVLLQAPFQLLSYLLFDRQVSPDRVLSLLQQEGLRLSVQQVIVQRCC
ETLPVWISCPADDSDSNEANLSALLQQHAQEHVSTLGITEPRPEPRTTPNPPPSSPPPSS
PPSTSSFLLTPSAVSFLKSRSPLLATLACLSACKGEIARSQTSGWSGYFRSSRREVSLDG
EQISREADNLLKEFPILRAYLHTMAEPLLGALSGEGDEASVGLGAVVCGKRLVRLLLSGP
QDEVAQAVAAEAFQKALSSGDLSRALALLELYGQGCSQEGDLRDRLLACAALEDGDDGIG
QLFRVQDANLRARVALQALERWPLSACLELLEFCLSEPSTDASLRTDLELKKKELDIYHR
MLNLQPPFPWATWQELRTESKTNSEAMLCRMVEAKEFALCVQWVELYPVSNRLRLKLQTE
QLLYLLEQGQTDEAFQLLEGLSDCGVGLDVCERALDRRPGLAACHFLADYLTLHFQSQVS
PARRRHIHALHLGSKVLLTLPPAARQEYFPLLSEPLLMLEQLLMNLKVDWADVAVRTLRS
LLVGQEAGFAAEDIDKLLADYACKALDFPCAPREMSRSDSVISLQDLLTAAQDSCPMSPC
RNESPATSAGSTPTHTSSSNSADRENDRSSAGKRRRSSAKFQPPDRPPARKDWVPDTKQD
VCMICRRERFTMFNRRHHCRRCGRLVCQSCSEHKMSVEGCPGDEEVRVCNECYAYFHPDS
DDEQEPSEGNAATGSTVVTEEALDGMLHLPEVVQRQIRLSPNHTENQLLRTEFYYEQAPS
AYLCVAILSLHDDQTACGHRLIVHCRSLSRKLTNPEVDACLLTDIMRQLLFSAKMMFVKV
GRSHELALCDSVHSYISKVDVLKILVTANYKYIPSLDDILESSAVTRLRNQLLEGEHYQL
AVEVSTKSGLDPCGVWQAWGMASLKAGDLSGAREKFARFLKPPLDRNQLNLGPLLLQEVV
QHLETTVQPGVATSSGEDVLASLRELEEALSEAGPVDRPEGQTLRSSLHQECLYYLNTYG
THMALICFYMRHDCTTEALTYLLNKECPDEVFLEAVLQPSLERGRLGMLQGILEKLDPGL
ETSSRYLIASCQFLQRRGYYNTLYQLQQFMMDQVRAAMTCIRFFTHGASSYLQLGEHNRW
LVRAKEHLRTYLQEQQGRGAGKRRAPVNSFRKMMSSTDVSRHMNTIELQLEVTRFLQRCE
AASSSKATQNSTSTSGSSAPPTLFGGSPMKVEVACKVMLGGKNIEEGFGIAYRVIQDFQL
EAQAVYVRAGQRLIRQRQYGAVRQLLKCVGESGTATKNDCDALILSCVAIADKGPADAKE
LEGLILEVKSTESKIKAYLLCGKLRPAYLLAVKLEPSRAGPLVQDVLQAADGAQDSVMQN
ICAQWLSEHDGKASQQRQGRP
Download sequence
Identical sequences G3PF96
ENSGACP00000016270 ENSGACP00000016270 69293.ENSGACP00000016270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]