SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016290 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016290
Domain Number 1 Region: 1040-1098
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000297
Family UBA domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1627-1703
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000204
Family Canonical RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016290   Gene: ENSGACG00000012320   Transcript: ENSGACT00000016322
Sequence length 1816
Comment pep:known_by_projection group:BROADS1:groupXI:11499498:11522052:1 gene:ENSGACG00000012320 transcript:ENSGACT00000016322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDKKKKKQEEKKKKEGAQKKATEQRTKAVPDSARRDPTPPLPPISPSAVPSAPPSGGNG
KRAPSTAQQPQNLLQQRYPPREVPPRFRQQEHKQLLKRGQPLPAGTPPPTTTGRPAAAEP
AAAVAALSSLAGSSSSTASLPTELPPQRGQGAQYDNPLWGNPPANRSATSASTNPSDWDQ
LITDQKETEAWPSITLSQSQAPPGGCSSDTDPGHLNMASGANSQTGHFPANHLSSKVNSG
PSPANHTGTSMLSSPVAANCSWGSGPGSSHCPPQSSVGGEGKNDSPGGAGGSRGWGSSSS
SSNTNFNLNLNPNANPSAWPMLGHDGVGTGGGSSGGANTISPPQPTPNLCNPPGPPPVQT
SSCTGINANSSAGIGSAWGSLMTSDSPEPHPSPSTNVSFSSEPQNLKTDGPNHTNKQEPP
SPIRNLPGWGSEPVHLGSMDQTPSGGQQVNGEDNSSVWGNSGDSKAPSSKEAPGWDSGWG
RGGGAGNSGGWGDQSGGSWGKPRTEEAQGGWAAPGSPPQDPQATPWNRAVSTAAASEGSS
DSMEAQPPHRDSSSRDNPAPPLPAQDLDPRVLCNTGWGQTPVRQHTTWDMVKSKRKNDAA
ADSWGSGPTTPNDAQGPASINMAPSSISVASGWGGGIAANNPPIAGWGEPVNNVKPPGGP
GGWGNPPTGAPTPSVPKNGGQSWAEEKPTGWDDSRSKATSQGWGEQPKASHSWGNGGGSN
NPGDWREPEESKKNPTKPGWEGEAGGWKENQRSWGGSSSGPVTPGAGGNGGWAETACQRP
SGPAQSWGAKPQDGPGGSSAAGSMGSWAGSGSVKQGGSWAGSKKESSAPPTGWEEPSPPS
IRRKMEIDDGTSAWGDPVNHRKSVNLWDRNNPGKSQAKNHTPNPPNPGPSSGPMDPVVQH
QSGPSHNRSPLIAQGSTSWGETSSSHTKPESTWGEAAPAPVSVDNGTSAWSKSSGGWGDS
NPDGYGRGNLTMTSASCKPGPKPMQDGWGGGGEELSVTGGQWDAEEGDMWNSVASQESNP
SCNSWGNASKKGPPKAKVPGKQEDAWMMNRLIKQLTDMGFPRDPSEEALKSNNMSLDQAM
SALLEKKTELDKRGMGITGHDYNGLINKPMSCPRPPLLSKDHSTDPRLPFMEKNLSVSRK
YFTVKVDNKNNPILLKCNYHLVVWLKGIYILCAQDETNQQRQMQSGMFGGGGAVQARAPP
QPPVQPLSSSQPSLRAQVPQFLSPQVQAQLLQFAAKNIGLNPALLTSPINPQHMTLLNQL
YQLQLAYQRLQIQQQMLQAQRNVSGPIRQQEQQVARTINNMQQQIQQHQRQLAQALLMKQ
QQQQPPPSHSGLHPGGPKSALDLFPGHPHAAGLHDLQTKEPQSSPNSYGPYSLSGLNQNM
NVNCVEVGGLSMKEPHQPQSRLSQWTHPNSIESLSGSSSPLEPNLGKHGEKRNGILGANL
GPPGKLPQMEDSYSHYNLMSSSDSPNSPLVPQDNWGQVKGTSDKMANGTNINWPPEFCPG
VPWKGLQNIDPETDPNVTPGSVPSGPTINTNIQDVNRYLLRDRSAGKLSEMKSTWSPGPV
SHNQASLSHELWKVPQGPRSSNAAPSRPPPGLTNSKPTSTWGGNSLGLAQGWSSSYTTAG
TTWSTDSATRASSWLVLRNLTPQIDGSTLRTLCMQHGPLITFHLNLTQGNAVVRYSSKDE
AAKAQKSLHMCVLGNTTILAEFAGEDEVNRFFAQGQSLGGTTSWQATPGSNQTRMGGAGS
GAPHPIGHSPHWNNNNNGGGGLGAGGAKTGGELLWGGVQQYSSLWGPPSGEEGRVMGSPT
QINTLLPGDLLSGESM
Download sequence
Identical sequences G3PFB6
ENSGACP00000016290 69293.ENSGACP00000016290 ENSGACP00000016290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]