SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016340 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016340
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-23
Family DIX domain 0.0022
Further Details:      
 
Domain Number 2 Region: 239-349
Classification Level Classification E-value
Superfamily PDZ domain-like 5.72e-23
Family PDZ domain 0.0000309
Further Details:      
 
Domain Number 3 Region: 418-455
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000484
Family DEP domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016340   Gene: ENSGACG00000012365   Transcript: ENSGACT00000016372
Sequence length 689
Comment pep:known_by_projection group:BROADS1:groupXII:16158258:16176240:1 gene:ENSGACG00000012365 transcript:ENSGACT00000016372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETKIIYHIDEEETPYLVKLSVSPEKVTLADFKNVLNNRPVNSYKFFFKSMDQDFGVVK
EEISDDNAKLPCFNGRVVSWLVLAESSHSDGGSQCTESHPELPPPLERTGGIGDSRPPSF
HANAVSSRDGLDTETGTESLLSHRRERERERARRRARETELPRINGHSKSERTARDSAMG
YDSASVMSSELESSSFVDSEEDENASRLSSSTEQSSSSQLMRRHKRRRRRHKVAKIDRSS
SFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRI
EPGDMLLQVNDVNFENMSNDDAVRILREIVSKTGPISLTVAKCWDPSPRSYFTIPRAEPV
RPIDPAAWISHTTALTGPYPHYGKNNQPSPATHSMKHPFCDSSPMPEFDDLPLSASKTDM
ATVVKVMQLPDSGLEIRDRMWLKITIANAVIGSIVCIVLLAEHVGPFDIIRSCSRRLSLS
LVYHVFIHSQRCLGFSHEGQIELGDMKSELLTLTINDYSSRSSGSNPSAGKGRRSSPQEK
GQRSTCSESEPRVRGGRRGERSASQMSHHSHAVSSHSHARSSLSHSQSHRSHSQNSHPSF
VHSHAPFAQPGPGSCAHSERSHASSYGPPGLPPPYCLARLAPKTSVSSTTPPGAPPGREL
ASVPPELTASRQSFQHAMGNPCEFFVDIM
Download sequence
Identical sequences G3PFG6
69293.ENSGACP00000016340 ENSGACP00000016340 ENSGACP00000016340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]