SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016358 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016358
Domain Number 1 Region: 394-442
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000812
Family RING finger domain, C3HC4 0.0032
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000228
Family Ubiquitin-related 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016358
Domain Number - Region: 314-363
Classification Level Classification E-value
Superfamily RING/U-box 0.00318
Family IBR domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016358   Gene: ENSGACG00000012371   Transcript: ENSGACT00000016390
Sequence length 451
Comment pep:known_by_projection group:BROADS1:groupVI:17027226:17032875:-1 gene:ENSGACG00000012371 transcript:ENSGACT00000016390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIYVRYNLGPCVPVELQEEASVADLQQLVGSQQGVHAELLRVLFAGRELKSSFTLQGCD
LPEQSTVHVVLPKSAPTPGHLLLLRERLAGGGQEEGNSLARLDISSSRFPCTPPGLDGSN
GGGGEGAEGGVRTCSTFFVYCKRCKSIQPGKLRVCCSSCRETTFTLSRGPSCWDDVLLPG
RVHGFCQSDACVGNEAEFYMKCASHPTPEDEVSVALDLIMTNSREVPCMACSDTTELVLV
FQCAERHVICLHCFHRYCQTRLNDRRFFSHPVIGYSLPCAAGCADSLIKELHHFRILGDD
QYGRYQKYGAEECLLMNGGLMCPSPGCGAGLIPPDDSRRVTCDRHLGCGFVFCKCCREGY
HEGACLTEQAPPIAESSQGFVVEEEASVKGRWDQASLLLLQETTKRCPQCSVPVERDGGC
MHMQCPLCRAEWCWLCGVSWNTDCMGNHWFG
Download sequence
Identical sequences G3PFI4
ENSGACP00000016358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]