SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016377 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016377
Domain Number 1 Region: 48-141
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 6.15e-28
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00018
Further Details:      
 
Domain Number 2 Region: 126-238
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.02e-24
Family UBX domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016377   Gene: ENSGACG00000012393   Transcript: ENSGACT00000016409
Sequence length 249
Comment pep:known_by_projection group:BROADS1:groupXVIII:13788035:13791408:-1 gene:ENSGACG00000012393 transcript:ENSGACT00000016409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEFDSVGGERDDNCEESEECEEQAPIRRSFSVEDLLHEVEKICYDASGTSKVEMVVRLW
KDGFTVNDQEFRSYSVPENQDFLDSIKRGELPKEWESRAEEEELEISVEDLTEENYVPRR
KAFHPFSGQGYRLGSVAPRVVARSPSVHEDGESPPIPMVTLDHALPVTSLQIWLADGRRL
VQRFNLSHRIADVQDFVARCQRSCPPFVLTTSVPFRELNDKELSLGEADLANAVIVQRPL
DTPAPFGHS
Download sequence
Identical sequences G3PFK3
ENSGACP00000016377 69293.ENSGACP00000016377 ENSGACP00000016377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]