SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016395 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016395
Domain Number 1 Region: 7-119
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.1e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.0011
Further Details:      
 
Domain Number 2 Region: 132-169
Classification Level Classification E-value
Superfamily PH domain-like 0.00000154
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016395   Gene: ENSGACG00000012403   Transcript: ENSGACT00000016427
Sequence length 198
Comment pep:known_by_projection group:BROADS1:groupXI:11593425:11596872:-1 gene:ENSGACG00000012403 transcript:ENSGACT00000016427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNLSRNQKELLELLKLAVNSRCADCAAPDPGWASYKLGVFVCLTCSGIHSGLSSRVKSI
KLDSWEDEQVEFMKSRGNDHAKAVYEKAVPAYYYRPREKDCVILREQWILAKYQRKEFTG
ETKYPPVSYTAGFYEGMLWKKGKDNAQFFKRKFVLSQREFTLSYYNKENVSSQKLDELHT
GRAFCIWSRHVKYKIQDE
Download sequence
Identical sequences G3PFM1
ENSGACP00000016395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]