SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016398 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016398
Domain Number 1 Region: 7-119
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.35e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.0011
Further Details:      
 
Domain Number 2 Region: 244-357
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-22
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 
Domain Number 3 Region: 129-234
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016398   Gene: ENSGACG00000012403   Transcript: ENSGACT00000016430
Sequence length 377
Comment pep:known_by_projection group:BROADS1:groupXI:11593988:11596880:-1 gene:ENSGACG00000012403 transcript:ENSGACT00000016430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNLSRNQKELLELLKLAVNSRCADCAAPDPGWASYKLGVFVCLTCSGIHSGLSSRVKSI
KLDSWEDEQVEFMKSRGNDHAKAVYEKAVPAYYYRPREKDCVILREQWILAKYQRKEFTG
ETKFGTTGFYEGMLWKKGKDNAQFFKRKFVLSQREFTLSYYNKENESKGPKAVISIKDLN
ITFQPEKIGHSHGLQITFQDGNHTRNLYVYHESAQEIVTWFNAIRAARYAYFKTAYPTGS
DKELIPKLTRNYLKEGYMEKTGPSRKETFKKRWFTLDSQNRKLLYFKGQLDAEELGVIFI
GTESKGYSVKECDQMHARGNKWKYGVAVGTPRRQYLFMCEQEGEQREWLDALRQVLSRPM
APQDYTSKHGWGTPRTR
Download sequence
Identical sequences G3PFM4
ENSGACP00000016398 69293.ENSGACP00000016398 ENSGACP00000016398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]