SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016402 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016402
Domain Number 1 Region: 672-817
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-34
Family Phosphotyrosine-binding domain (PTB) 0.0041
Further Details:      
 
Domain Number 2 Region: 604-658
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000407
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016402   Gene: ENSGACG00000012408   Transcript: ENSGACT00000016434
Sequence length 825
Comment pep:known_by_projection group:BROADS1:groupXIX:15756474:15768486:1 gene:ENSGACG00000012408 transcript:ENSGACT00000016434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTGGTDVFPVSVFFLTARSQRAVSCVSRPAHDISLEEFDDEDLSEITDDCGIGLNYDSDP
YEKDSLILEKSDMHHPVCSFQDDFQEFEMIDDEDDDEEEDEDEELDPDAPPSPSASPPLS
PTLGTLKSRPTTLNLTTAVSQDSLNNNSSLSPKKGSWQDSLRKTSHGIPPKQAGEGGNPQ
SPHRPLLCDMEGNRRERPEYANDSTSPSSDPGIADMNQQGYMTSDQDKDLSSPGSDSDIE
GELEVAFACGGTVVSNMISSISETELDLTSDESSSGRSSHLTNSIEEASSPTSDQELDLD
ADFKRSFYLPVGPRLMPSADEYDETSEGDSESESEDDLSENSDSPWLLSNLVNRMISEGS
YPISCPEDCFKRKASVSDTISPSSDIGDGDGFNDEDQEKKSELGGSEKEEKEGEGYRKGV
MEPGEKGKSMDSLNGGALISPCLYSNSPAGHTITPLVLEHCANNGRGTAEFHSNLTYSTD
NDEEEDDGDSYPFLGGLREEPNEDDGLAYDSMKYTLVVDENTTLELVSLRRYALMFELVL
NYGREDEELRPELLSSSEDSSPEADLPFSKKFLNVFVNSTSRSSSTESFGLFSCTINGEE
RDQTHRAVYRFIPRHADELELDVDDPLYVEEEEDDYWYRGYNMRTGERGIFPAFYANEVI
GQSKELLGMKRNPAWIETFGVQFLGSVEVPNHQGNGILCAAMQKIAISRKRTVHVRPPSL
CELEISLQGVKLIMSLEDDYDALDEYDRCSHFFQMKNISFCGCHPRNNCYFGFITKHPML
NRFACHVFVSQESMRPVAECVGRAFQEYYQEHLEYACPTEDIYLE
Download sequence
Identical sequences G3PFM8
ENSGACP00000016402 69293.ENSGACP00000016402 ENSGACP00000016402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]