SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016419 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016419
Domain Number 1 Region: 51-244
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.93e-47
Family Protein kinases, catalytic subunit 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016419   Gene: ENSGACG00000012420   Transcript: ENSGACT00000016451
Sequence length 250
Comment pep:novel group:BROADS1:groupXX:13634011:13636555:-1 gene:ENSGACG00000012420 transcript:ENSGACT00000016451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFPPSPQSAEEKNQQMALVPAGGPEPTRDFQRRMRPQDRPAEASMAYPTGTLAQGAFGK
VYKQKYNDTWAAIKKVPQHLINRKDLERECDVYKKAKHPNIVKLLGNINLKDGKWIIPLE
FIFGEDLETTIFKASNSKIQLSPSIKGTIILGMCEGLFHLHSRDIVHQDLKPDNIMVEHG
TNRAVIIDLGLAKFFKFGLSSAMDMGNPAYSAPEVLQMGTQRDQRSDVWAMGKIIAELCA
RIRLHTPSVC
Download sequence
Identical sequences G3PFP5
ENSGACP00000016419 ENSGACP00000016419 69293.ENSGACP00000016419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]