SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016502 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016502
Domain Number 1 Region: 556-644
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-20
Family Third domain of FERM 0.0053
Further Details:      
 
Domain Number 2 Region: 369-461
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 267-311
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000432
Family Second domain of FERM 0.012
Further Details:      
 
Domain Number 4 Region: 492-555
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000667
Family Second domain of FERM 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016502   Gene: ENSGACG00000012478   Transcript: ENSGACT00000016535
Sequence length 667
Comment pep:known_by_projection group:BROADS1:groupXVIII:14061287:14067924:-1 gene:ENSGACG00000012478 transcript:ENSGACT00000016535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMTAAEYGEKSWELSVQVDQKDGDESMKFKLRVKGDLHVGGLMLKLVEKIKAPQDWSDHA
LWWEQRKCWLLKTHWTLDKFGIQADADLRYTPQHKPLLLQLPNMKTIKMTVSFSSVVFKA
VAEICQMLNIRRSEELSLLKPPDDPSKKKKKKDKNSAEEDIWDVDLFGGGPGGTEQGPMH
SKTMTATYDPENGMPVSATSLWFGENPLAESQPNLPPAELAKMYRPLSPVDKAPYSAGWL
DSSRSLMEQDIQDEEKLLLRFKYNVFFDLNPKYDGVRITQLYEQARWSILLEQIDCTEEE
MLMFASLQYHICKLTLSSEPLDHSNEPEIDEVEAALSNLEVTLEGGLADRILEDITDIPE
LADTLRLFRPKRLTLRSYKEYWFVFKDTTISYYKNKETSSGEPLEQFHLRGCEVVPDVNV
TEKKFGIKLLLPVADGMNEVYIRCDNQTQYAKWKAACILASKGKTMAYSSYKSEVRNIQS
FLQMKSLAPPPGQAAPDLNAMEMNAECFFSPRYAKKHKTKQLTARILEAHQNIARLSLME
AKMRFIQAWQSLPEFGINYYIVRFKGSKKDEILGISYNRLIRIDMSSGMPITTWRFANMK
QWNVNWEIRQVTIEFDQNVSMAFCCVSCDCKVVHEFIGGYIFLSTRSKDQNETLDEELFH
KLTGGQE
Download sequence
Identical sequences G3PFX8
69293.ENSGACP00000016502 ENSGACP00000016502 ENSGACP00000016502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]