SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016522 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016522
Domain Number 1 Region: 317-656
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.93e-121
Family Mammalian PLC 0.0000000045
Further Details:      
 
Domain Number 2 Region: 899-962,999-1170
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 8.63e-63
Family C-terminal domain of PLC-beta 0.0000254
Further Details:      
 
Domain Number 3 Region: 148-314
Classification Level Classification E-value
Superfamily EF-hand 1.47e-48
Family EF-hand modules in multidomain proteins 0.0000048
Further Details:      
 
Domain Number 4 Region: 16-146
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-44
Family Pleckstrin-homology domain (PH domain) 0.0000281
Further Details:      
 
Domain Number 5 Region: 676-794
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.86e-24
Family PLC-like (P variant) 0.0000619
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016522   Gene: ENSGACG00000012490   Transcript: ENSGACT00000016555
Sequence length 1215
Comment pep:known_by_projection group:BROADS1:groupXVIII:14115259:14178849:1 gene:ENSGACG00000012490 transcript:ENSGACT00000016555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAQPGVHALQLKPVSVPESLRRGNKFMKWDDDSTTVTPVTLTVDPKGYFLYWTDQNKD
TDLLDISHIKDARNGKCTKTPKEAKLRELLDVSTLAGKMENRMLMVVSGPDMVNITYLNF
MAFQEETAKEWAEELFNLASNLLVQNMSREDCLEKAYTRLKLQLNPEGRIPVKNIFRMFS
ADRKRVETALENCNLPSVRNDSIPPEDFTPEVYNMFLANICPRTELDHIFSDVGAKTRPF
LSVEQMTEFINNKQRDPRLNEILYPPLKPEQVQVLVDKYEANASLAQKGQMSLEGFARYL
SGEENSIMPPEKLDQSEDMTLPLSNYFINSSHNTYLTAGQLAGNSSVEMYKQVLLSGCRC
IELDCWKGRTTEEEPVITHGFTMTTEISFKEVIEAIAEWPLKRWPFPFFFPLETPVDLPK
QQAKMAEYCRSIFGDALLTDPLEKYPLESGVPLSSPMELMGKILVKKKKKHHKTDGSTKK
KLSEQWYAFIHPYSHAPCLCVSGEVEAESEDDDDDDDDCKKGSMDEGTAGSEAFATEEMS
NLVIYIQPVKFNSFEASKKINRSFQMSSFVETKALEQLTKCPVEFVEYNKLQLSRIYPKG
TRVDSSNYNPQLFWNAGCQLVALNFQTIDLSMQLNLGMYEYNGKCGFRLKPEFMRRPDKH
FDPFTESTVDGIVANTLSVKIISGQFLSDKKVGTYVEIDMFGLPVDTKRKAFKTKTSQGN
AINPVWEEEAIVFKKVVLPTLASLRIAVFEEGGKSIGHRIIPVSAIRPGYHYISLRNEKN
QALTLPTLFVYLEVKDYVPDTFADVIEALSNPIRYVNLMEQRANQLAALTLEEGGEEEGD
KEVEAGSDAPAESKVDPRATLPAENGLSHTPVIAPKPPSLVGHQPQSAGSLKPSVKTEDL
IQSVLTEFEAQTVEELKQQKGFVREQKKQYKEMKELVRKHHRKTSELIKEHTARVSELQN
QHQRGRSALQKSHKRDGKKSRSEHSLSSLDQELCELDQDYSLRLAELKEQQQQQLLQLRQ
EQYYSEKYQKREHIKQLVEKLTAIAEECQSAQLKKIRDVCEKEKKDIKKKMDKKRQEKIN
EAKSKDKNATEEEKLEINRSFVNEVVQYIKRLEDAQSKRQERLLEKQKDIRQQILDERPK
LQSDLDQEYQDKFRRLPVEIQEFVQDSGRAKLGHDGVHGSLSAASSATERLNHKASPSED
DTEDGSSERVYDTSL
Download sequence
Identical sequences G3PFZ8
ENSGACP00000016522 ENSGACP00000016522 69293.ENSGACP00000016522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]