SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016528 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016528
Domain Number 1 Region: 54-332
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.26e-89
Family Protein kinases, catalytic subunit 0.0000202
Further Details:      
 
Domain Number 2 Region: 678-790
Classification Level Classification E-value
Superfamily KA1-like 8.17e-26
Family Kinase associated domain 1, KA1 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016528
Domain Number - Region: 341-395
Classification Level Classification E-value
Superfamily UBA-like 0.000239
Family UBA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016528   Gene: ENSGACG00000012485   Transcript: ENSGACT00000016561
Sequence length 790
Comment pep:known_by_projection group:BROADS1:groupI:15921096:15952634:-1 gene:ENSGACG00000012485 transcript:ENSGACT00000016561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCEAPPAPAASQPHMNHTSLSASRSEKGTGWSSRSLGARCRNSIALCSDEQPHIGNYRLL
KTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKTLNHPNIVQLF
EVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKFRQNLWSCDHTTRNAVMHFLF
VMLAHIVSAVHYCHLKNIVHRDLKAENLLLDADANIKIADFGFSNEFTEGSKLDTFCGSP
PYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRVPFYM
STDCEGILRRFLVLNPAKRCSLDQIMKDKWINIGYDGEDLKPHTEPVEDLNNTSRIDVMV
GMGFTRDEIRDSLSNQKYNEVTATYLLLGRKNETDGGESRSASSLSLARVRPSTITNGTS
KPTASSSSAATSSSTGHKAQRSASTYHRQRRHSDFCGPAVPGSAQPKRSPSGVGEGAGLK
EERLSSRKPSTSTIGSRSIPTPSSPMVSSAHNPNKAEIPDRRKETNVTTNNIPASAMTRR
NTYVCTDRSGTDRHSLLQNGKENSSLSHRLPPASPSTHSIAGASAASSSSTPSTRLSRGS
TVRSTFHGGQIRDRRPPSHATPASPTLSYDASPLPHARTRTTTNLLSKLTSKLTRSNNTF
FFLLRVTDEPERISRSPVTSRHLSGHQKAAEPRTPRCGWDVRVRSPRDPAEVVLALREAA
QGCGCQVHLAGPFLLSCTHGAAGARVAFEAEVCQLPSGLGQSSGVRFKRLWGAPLAFRDI
ATKVSKELEL
Download sequence
Identical sequences G3PG04
ENSGACP00000016528 69293.ENSGACP00000016528 ENSGACP00000016528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]