SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016533 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016533
Domain Number 1 Region: 55-310
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-96
Family Protein kinases, catalytic subunit 0.0000103
Further Details:      
 
Domain Number 2 Region: 647-759
Classification Level Classification E-value
Superfamily KA1-like 7.52e-26
Family Kinase associated domain 1, KA1 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016533
Domain Number - Region: 319-373
Classification Level Classification E-value
Superfamily UBA-like 0.000235
Family UBA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016533   Gene: ENSGACG00000012485   Transcript: ENSGACT00000016566
Sequence length 759
Comment pep:known_by_projection group:BROADS1:groupI:15921096:15952387:-1 gene:ENSGACG00000012485 transcript:ENSGACT00000016566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSDAGVSHASLSVSPQHTSLSASRSEKGTGWSSRSLGARCRNSIALCSDEQPHIGNYRL
LKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKTLNHPNIVQL
FEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVHYCHLKNIVHRD
LKAENLLLDADANIKIADFGFSNEFTEGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWS
LGVILYTLVSGSLPFDGQNLKELRERVLRGKYRVPFYMSTDCEGILRRFLVLNPAKRCSL
DQIMKDKWINIGYDGEDLKPHTEPVEDLNNTSRIDVMVGMGFTRDEIRDSLSNQKYNEVT
ATYLLLGRKNETDGGESRSASSLSLARVRPSTITNGTSKPTASSSSAATSSSTGHKAQRS
ASTYHRQRRHSDFCGPAVPGSAQPKRSPSGVGEGAGLKEERLSSRKPSTSTIGSRSIPTP
SSPMVSSAHNPNKAEIPDRRKETNVTTNNIPASAMTRRNTYVCTDRSGTDRHSLLQNGKE
NSSLSHRLPPASPSTHSIAGASAASSSSTPSTRLSRGSTVRSTFHGGQIRDRRPPSHATP
ASPTLSYDASPLPHARTRTTTNLLSKLTSKLTRRVTDEPERISRSPVTSRHLSGHQKAAE
PRTPRCGWDVRVRSPRDPAEVVLALREAAQGCGCQVHLAGPFLLSCTHGAAGARVAFEAE
VCQLPSGLGQSSGVRFKRLWGAPLAFRDIATKVSKELEL
Download sequence
Identical sequences G3PG09
ENSGACP00000016533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]