SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016537 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016537
Domain Number 1 Region: 18-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-96
Family Protein kinases, catalytic subunit 0.0000103
Further Details:      
 
Domain Number 2 Region: 597-707
Classification Level Classification E-value
Superfamily KA1-like 9.81e-26
Family Kinase associated domain 1, KA1 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016537
Domain Number - Region: 282-336
Classification Level Classification E-value
Superfamily UBA-like 0.000214
Family UBA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016537   Gene: ENSGACG00000012485   Transcript: ENSGACT00000016570
Sequence length 707
Comment pep:known_by_projection group:BROADS1:groupI:15921096:15952276:-1 gene:ENSGACG00000012485 transcript:ENSGACT00000016570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GARCRNSIALCSDEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPT
SLQKLFREVRIMKTLNHPNIVQLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEA
RAKFRQIVSAVHYCHLKNIVHRDLKAENLLLDADANIKIADFGFSNEFTEGSKLDTFCGS
PPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRVPFY
MSTDCEGILRRFLVLNPAKRCSLDQIMKDKWINIGYDGEDLKPHTEPVEDLNNTSRIDVM
VGMGFTRDEIRDSLSNQKYNEVTATYLLLGRKNETDGGESRSASSLSLARVRPSTITNGT
SKPTASSSSAATSSSTGHKAQRSASTYHRQRRHSDFCGPAVPGSAQPKRSPSGVGEGAGL
KEERLSSRKPSTSTIGSRSIPTPSSPMVSSAHNPNKAEIPDRRKETNVTTNNIPASAMTR
RNTYVCTDRSGTDRHSLLQNGKENSSLSHRLPPASPSTHSIAGASAASSSSTPSTRLSRG
STVRSTFHGGQIRDRRPPSHATPASPTLSYDASPLPHARTRTTTNLLSKLTSKLTRSRHL
SGHQKAAEPRTPRCGWDVRVRSPRDPAEVVLALREAAQGCGCQVHLAGPFLLSCTHGAAG
ARVAFEAEVCQLPSGLGQSSGVRFKRLWGAPLAFRDIATKVSKELEL
Download sequence
Identical sequences G3PG13
ENSGACP00000016537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]