SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016558 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016558
Domain Number 1 Region: 313-485,514-685
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.63e-137
Family Mammalian PLC 0.0000000273
Further Details:      
 
Domain Number 2 Region: 918-973,1013-1165
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 4.18e-55
Family C-terminal domain of PLC-beta 0.0012
Further Details:      
 
Domain Number 3 Region: 141-312
Classification Level Classification E-value
Superfamily EF-hand 3.18e-54
Family EF-hand modules in multidomain proteins 0.00024
Further Details:      
 
Domain Number 4 Region: 13-140
Classification Level Classification E-value
Superfamily PH domain-like 6.34e-37
Family Pleckstrin-homology domain (PH domain) 0.0022
Further Details:      
 
Domain Number 5 Region: 707-822
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.09e-25
Family PLC-like (P variant) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016558   Gene: ENSGACG00000012503   Transcript: ENSGACT00000016591
Sequence length 1180
Comment pep:known_by_projection group:BROADS1:groupXVIII:14203391:14223968:1 gene:ENSGACG00000012503 transcript:ENSGACT00000016591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKSYEFNWQKHLPEFMQEGASFDRFDEDPFVFEPNCQMKVDEYGFFICWKSEGKEGQVL
ECSLINSIRVCGVPKDPKILSSFEAIGKTEADLEGCIICICSGTDLVNLNFMFMVAESPD
TARKWIEGLRSVIHNFKANNVCPMTCLKKHWMRMCFLTNVNGKIPVRGITRTFASGKTEK
GIFQALKDLGLPSGKNDEIEPSDFTYDIFYLLTQKICPRTDIEELFKKINGNKTDYLTVD
QLVSFLNENQRDPRLNEILFPFYDPKRAMQIIEKYERDEELKKKACMSSDGFCRYLMSDE
NAPVFLDRLELYQDMEQPLAHYFISSSHNTYLNGRQFGGKSSVEMYRQVLLSGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSDYPVILSFENHCSKPQQYKM
AKYCEEIFGDFLLKQPLENYPIEAGRPLPSPNDLKRKILIKNKRLKPEVEQKQLEAFKKH
MEAGETNTPAIIMGEENEEDTENEAVSSLSEATAEKEANSVSKSNAVSLTKDERNSIKKA
VEEPEDSEEALIAQYTYVGATTNIHPWLSAMVNYAQPVKFQSFDVAEERNIHHNMSSFNE
SVGLGYLKTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLA
MQLNQGKYEYNGSCGYLLKPDFMRRSDRMFDPFSETPVDGVIAATCSVQVFSGQFLSDKK
IGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPAYNEEPFVFRKVILPDLAVLRIGVYDD
NNKLIGQRLLPLDGLQAGYRHISLRNEGNKPLSLPTIFCQIILKTYVPDGFGAIVDALSD
PKKFLTIAEKRADQMKALGIDTNDIADVPSGSSKNDKKGKGKGDTVKASVTPQASSDMAH
TSNSAQNNTAETKKDNTLVPNVSIDDLKLMKTYLKLIKKQQKELNSLKKKQSKDQTTMQK
SHCTQVDKMVSQHDKEKTTLEKLLEKAIKKRGENNCQELKKETEDKIQTLVADHKVKVKD
ITALHTKEWSELLGGHSGEEQGLKDAHVTQQCEHLKKLLTAVQEQQTTQLKLIHERQSKE
MRANQAKMSMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLDERKRLAMKHQKEMEQ
LEKNQREQLDKLEKFNEQARDMQQMVKLEEEMDRRPATVV
Download sequence
Identical sequences G3PG34
69293.ENSGACP00000016558 ENSGACP00000016558 ENSGACP00000016558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]