SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016585 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016585
Domain Number 1 Region: 38-278
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-88
Family Calponin-homology domain, CH-domain 0.00000254
Further Details:      
 
Domain Number 2 Region: 295-415
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-32
Family Spectrin repeat 0.00012
Further Details:      
 
Domain Number 3 Region: 1222-1374
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-25
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 4 Region: 600-727
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-24
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 5 Region: 1538-1691
Classification Level Classification E-value
Superfamily Spectrin repeat 9.4e-24
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 814-949
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-23
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 1696-1800
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 8 Region: 1750-1904
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-21
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 9 Region: 424-526
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-20
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 10 Region: 693-803
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-18
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 11 Region: 1969-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-18
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 12 Region: 1036-1163
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-18
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 13 Region: 2353-2470
Classification Level Classification E-value
Superfamily PH domain-like 5.6e-18
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 
Domain Number 14 Region: 528-635
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-17
Family Spectrin repeat 0.00066
Further Details:      
 
Domain Number 15 Region: 951-1056
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000734
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 16 Region: 1384-1480
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000115
Family Spectrin repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016585   Gene: ENSGACG00000012524   Transcript: ENSGACT00000016618
Sequence length 2516
Comment pep:known_by_projection group:BROADS1:groupI:15998209:16046758:-1 gene:ENSGACG00000012524 transcript:ENSGACT00000016618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANASPDLDNVEAQRQLNNNNRQSSSGFWETECTSSKLFECSRIRALADERDAVQKKTFT
KWVNSHLARVSCRIADLYNDLRDGYMLTRLLEVLSGELLPRPTRGRMRIHCLENVDKALQ
FLKEQRVHLENVGSHDIVDGNHRLTLGLMWTIILRFQIQVIKIETEDNRETRSAKDALLL
WCQMKTAGYPEVNIQNFTTCWRDGLAFNALIHRHRSDLIEFNKLTRSNATHNLQQAFNVA
EQHLGLTKLLDPEDVNTENPDEKSIITYVVSYYHYFSKMKALIVEGKRVGKVLENCVEAE
KIINRYEALASDLLDWIEKTIAVISNQKFANSLTGVQQQLLAFTTYCTIEKPIKFQEKGN
LEVLLFTIQSKLRANNQKPYVPHDGKLISDINKAWERLEKAEHERGVALRKELIRQEKLE
LLAQCFDHKTTMRQAWLNENQRLVSQDNFGYDLPAVEAAMKKHEAIEADIASYEERIGVV
VELAAEMETEAYYDIRRILARKENILGQWSLLKELVAGRRTRLEKNLALQKTFQDMVYMI
DWMDDTQVQLLSKDFGKHLLEVDDLLQKHSLQEADIAVQAERVETLNTAALKFTTIEGYQ
PCDPQVICNRVNHVSTCLEELKQLAAKRREELEESRQLWAFFQELEESEAWIREKSSILG
AQGYGKDLSSVLKLLQKHKTLAGELLAHRSLLQNTMKRGKQILSDKSFGTAGIQERIMEV
KGEWKRLEDQAAQRLGHLQEALNFFQFSTETDDLVAWLQDAYRLVSSEDFGHDEYSTQSL
LKKHRGVSEAVDKHRMHVVALRKHMGALPLQYREQKEVQVRMGEVEQLYTEVAEVAVLRQ
QWLHDALAVYRMFSEVNACELWIDEKEQWLDKMEIPERLEDVEMVAHRFESLDQEMNSLM
GRILDVNQIVQQLLDGGHPSSTEVRGCQDHLNSRWNSIVELVEQKKDQLGSMLRLQNYLL
ECAEIKSQIQEKRKAIDATQYVGSDLGGVLALQRRLSTMEGALSVLEPKLLHLQEEAEQM
ATAHPARAMEVLMPFDGINVEWEELKRTLQGCEDSLMVAGRLQSFIQDLDSFLTWLVQTQ
TAAASDLLPNDLEEAEKLINKHAALKEEIGRYEEDYERLQAMNDLLESEEAPLPQAALQQ
WLQKLDVGWNKLLEMWESRREVLVQAHIFHLFLRDVKQAESFLNNQESALAHVELPTTVE
TVEAAIKKHKDFTTTMELNLHRIKAVIEAGESLISQSNIYSDRIKERIDTLANRGNQNRE
LAHQWLEKLNDQWELQRFLQDCHELGDWVCEKMLMAKDSSRDETQKLHKKWLKHQAFMAE
LAQNKEWLDKIEKEGQQLIQEKPELSTGVRRKLEEIRECWQDLESTTQAKARQLFEANKA
DLLVQSYESLDQRLGQLEGQLAYVDQGQDLTTVNKQLKKLHTMESQMETWYKEVGQLQMQ
VASIPQQTQIKETVAGRQAVVEARMVRLIEPLKERRRILLASKEVHQVGRDLEDEILWVQ
ERLPMAMSHEHGSSLQAVQQLMKKNQTLQRELQGHRSRMDDVLERAGIIASIRSPEADCV
RAGRDQLAQLWALLWAETERRQLILDAMYQAQQYYFDTAEVEAWLSEQELHMMNEEKGKD
EPSTLQLLKKHLVLEQTIEDYAETVGLLSQQCRQLLEMGHPDCEQISKRQCQIDRLYVSL
KDLVEERKSRLEQQYWLYQLNREVDELEQWIAQREVVASSPELGQDYEHVTVLQEKFTEF
ASETGSVGQERVTAVNQMVDELIDYGHSDAATIAEWKDGVNEAWADLLELMETRAQMLAA
SHQLHKFFSDCREVLAQIEDKHRRLPEVRARQGSTANTSTLQRLLHSFEQDIQLMVTQVR
QLQESAAQLRTVYAGEKAEAIACREHEVMQLWKELLTSCEECRVQITTETDKLRFFGMVR
DQMMWMESIICQIGTGEKPRDVSSVEVLMNYHQSLQSEVEARSRSTLECIEMGKTLLAAR
NPAAEEIKEKLDKVVAKQYELSEKWDKHWDVLQQLLEVHQFAQEAVVAEAWLTAQEPLIS
SNELGASVDEVEQLIRRHEAFRKAAATWEERFSSLRRLTTVEKLKAEQSKLPPTPLLGRK
VFLDPQDASPGVSTLPRLPLSPVMRQTIYIMMGEIGTEKAEVAVMAEVVLQEPCRERLHS
EPTRGPRGSRTDPLGQAEPQVQTHRDHRMERQLSSEQLIQARRDELPQELWREQAERREK
RGLERQTSSEHEGHGGHEGRRRERDRHRLERQESSEHDTGTRSHCLIEKRSTMAEIVEQL
QEREAAQPDWLPSLLPRLQARGEVPRLPNGVPEKPARLDRPRARDRPKPRRRPRPKEAGE
TTRRSRSAPAQSSPVVPQPPAHNAHHEGFLFRKLDIETLKKSTNRWVFRVMIMGITSGLA
EDRSSRAGGWTLVGESLLDLSHCHCDVTNGYKKKKNVFTLKTKDGSEFLFHAKDEEDLKV
WVGNITGSITEHEDIAKWGQPQPTTSSTDEGTRQDGSKAENRSERGGERSDRGDRI
Download sequence
Identical sequences G3PG61
69293.ENSGACP00000016585 ENSGACP00000016585 ENSGACP00000016585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]