SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016600 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016600
Domain Number 1 Region: 18-265
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.73e-26
Family Tryptophan biosynthesis enzymes 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016600   Gene: ENSGACG00000012553   Transcript: ENSGACT00000016633
Sequence length 274
Comment pep:known_by_projection scaffold:BROADS1:scaffold_98:321670:324931:1 gene:ENSGACG00000012553 transcript:ENSGACT00000016633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMKFLDLFGRLKSVVIGMIHVNALPGTPMGYMTMPQITEEACREAEIYRQAGIDGLIIEN
MHDVPYCFSVGPEVCACMTAVCAAVRGVCPRLPLGVQILSSANQQAVAVALASGLDFIRA
EGFVFSHVADEGLLDACAGDLLRYRKQIGAERVQIFTDIKKKHSSHALTSDVSIEETARA
AEFFLSDGLIVTGAATGAPADPRELRDVSQRVSIPVLIGSGVTYDNVERYLHASGMIIGS
HFKEGGRWAAAVDPEQVKRFMGKVRGLRTRGNAA
Download sequence
Identical sequences G3PG76
69293.ENSGACP00000016600 ENSGACP00000016600 ENSGACP00000016600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]