SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016618 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016618
Domain Number 1 Region: 80-181
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-23
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016618   Gene: ENSGACG00000012559   Transcript: ENSGACT00000016652
Sequence length 187
Comment pep:known_by_projection group:BROADS1:groupXX:14037063:14042396:1 gene:ENSGACG00000012559 transcript:ENSGACT00000016652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLVEIEKKLREAKAERERLLRERSRAKGATEGRFSPKVPGALRPHGLPLFLSPNFDLRA
HVESLGHGVSGCVDLRLTPRRCAGFLTKRGGRVKTWKKRWFLFDMDHKRLAYYTDCDERK
LKGVIYFQAIEEVYLDHLRTATSSPRPSLTFCVKTYDRLFFLVATNPMAMRIWMDVVVTA
TDEHSRY
Download sequence
Identical sequences G3PG94
ENSGACP00000016618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]