SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016622 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016622
Domain Number 1 Region: 200-349
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-32
Family Third domain of FERM 0.0014
Further Details:      
 
Domain Number 2 Region: 90-199
Classification Level Classification E-value
Superfamily Second domain of FERM 8.24e-22
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 3 Region: 4-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.78e-22
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016622   Gene: ENSGACG00000012555   Transcript: ENSGACT00000016656
Sequence length 1037
Comment pep:known_by_projection group:BROADS1:groupXIX:15974101:15999047:-1 gene:ENSGACG00000012555 transcript:ENSGACT00000016656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMTEGRRCQVHLLDDRKLELLVQPKLMAKDLLDLVASHFNLKEKEYFGIAYTDETGHFSW
LQLDRRVLEHEFPKKSGPIVLYFCVRFYIESISYLKDNATIELFFLNAKSIIYKELIEVD
SDVVFELASFILQEAKGDFTSNDVTRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKL
NGQSRGQAIVNYMSIVESLPTYGVHYYGVKDKQGIPWWLGLSYKGIFQYDHQDKVKPRKV
FQWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQ
HQFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGS
QESDSSQTAKKDMLAALRARQDALEETLKKRLEELKSICIREAELTGRLPKEYPLDPGEE
PPTVRRKIGTAFKLDEQKIHPKGEEEELERLEREFAIQSQITEAARRLASDPHVSSKKLK
KQRKTSYLNALKKLQEIENSINEHRVRSGKMPTQRASLIIEEANIGSEDSSLSDALVLDD
DDPHVTGTPTFSPVASPHRGLPPRPPSHSRPPPPQSLDGLRHLHYPRPDYDKSPIKPKIW
SESSLDEPYEKVKKRSSHSRYESSHRRFTSSGSADAGGSNSLQSSPIRNLPHWNSQSSMP
STPDLKTRNPHYVHSTRSVDISPTRLHSLAQHFRNRSSSLESQGKLLAPDPDAHPHTLGT
LGSPDFFLVPGRNSNGSDPLDDCSSCTSQSSSEHYYPSGGPPNSNPNYSTLGEDSPSKAR
QRQRQRHRSAGQLGSSNSGSMPNLAAKNGSGGGSSGGGVGGGHHGVYLHSQSQPSSQYRI
KEYPLYVEGSPNPVVVRSLESDQEGHYSVKAQFKTSSSYTAGGLYKEAWGGEEGGEGSGR
LTPSRSQIVRTPSLGREGGGGGGRAAVSEELRCWYQRSSGSLKERSHSHSGSTSSETGSQ
QGTLGHSRGSRVGTLAKCSPAASPHSQRSVTPCSEHTATPTPPCSPQHILNWQSGSTADS
SPTEDVCQSPPQPSSDA
Download sequence
Identical sequences G3PG98
ENSGACP00000016622 ENSGACP00000016622 69293.ENSGACP00000016622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]