SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016650 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016650
Domain Number 1 Region: 228-334
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00000000000714
Family gamma-Butyrobetaine hydroxylase 0.044
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016650
Domain Number - Region: 186-216
Classification Level Classification E-value
Superfamily WW domain 0.0853
Family WW domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016650   Gene: ENSGACG00000012596   Transcript: ENSGACT00000016684
Sequence length 351
Comment pep:known_by_projection group:BROADS1:groupXIII:14691957:14694822:1 gene:ENSGACG00000012596 transcript:ENSGACT00000016684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWVRWFVVWMEWSLDNVREIVAGGMQSIRECEICAFAIAMCVLLLFMWYCYRVGREHGSS
PLRDCRGRGKGKNGSMLEEQNGFAFCQSSECFRCTSAGESLNQRLYHSLQDYAKRYTWSG
MGRVHKGVRDQGRYLNSRPTIQRPEVFFLPDLPSAPFFSREVQRHDVELLEQSFPALLAE
FESIYHQPPARDGSSLPPGWKANNTPRGQWWTYYLVNQGTPLVLNVRRCPRAWRVLGQLR
TFIANNVFGNACFSVLTPGALITEHYGPTNVRLRCHLGLRVPPSCELVVGGEPQCWSEGS
CLLFDDSFLHRAFHEGGAEDGLRVVFMVDLWHPNVAAAERQALDYIFTPGR
Download sequence
Identical sequences G3PGC6
ENSGACP00000016650 ENSGACP00000016650 69293.ENSGACP00000016650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]