SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016740 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016740
Domain Number 1 Region: 22-238
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-52
Family DBL homology domain (DH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 529-823
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.21e-16
Family WD40-repeat 0.023
Further Details:      
 
Domain Number 3 Region: 250-328,417-474
Classification Level Classification E-value
Superfamily PH domain-like 0.000000112
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016740   Gene: ENSGACG00000012662   Transcript: ENSGACT00000016774
Sequence length 994
Comment pep:known_by_projection group:BROADS1:groupXII:16676928:16692542:1 gene:ENSGACG00000012662 transcript:ENSGACT00000016774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDDAGYLDVALCELKHPPPQLCPMPEGLSSQQVVRRLILSSIVQSESSYLDSLNRILQEY
QRPLLESQNGILKPKEVREIFYRLQEIHQCHFMFQIALASRVTEWDHSETIGDLFVASFS
KSMVQEVYSDYINNFTNAITLIKKACTSKPAFLDFLKNKQSSSPDRITLYGLMVKPIQRF
PQFILLLQDMLKNTPKTHMDRLPLQLALTALESLAEKLNEQKRQADQEAEIRQLARSVGD
RNLNKRLNSEQRQLIQCELLTEIVYGNKGQVIKMKERKVFLLNDILICANVDLKGPPNIS
GLVPVGPKYTVKWCSPLLQTQVVEVGQDRQQRSDSVITARRRSPTHSTTGKVFLGPPRLY
QELQELQHDLAVVEEVSLLVGTLHGTYQNLNSTVSQDWCLALQRLMRLKEEEIQKANKCR
LRLSIPGKPDKSGRPVNIIVVFNTPSPLSKITWVNRLHLAKIAHRQENTPGWEYAEEYVK
TKAPISCPLLTCKLPVFSSKTPSLKLEAALHSPSQSSLLGFCIASTSLPQGYLWVAGGES
SFNNGQVQIFSLNRATPRLVKTVPLSSPVLCLEYVKEPCPSTEEREAPSAAKIGNIICVG
LQDGSICVYSSVDTAVQCLLTLVNPDRSPVLCLKHSLSFLFAGLANGKVTVYHRRAGERL
WDVESCRLVSVGCEPVCSLLTLEDAVWASCANQVTVIQGSSLHTQLQSFTAHSDPGCSVR
HMIRSGGGVWMAFTQGSSIHLFHTETLEPLQDVNISTRTTHLRPGKGRVCVSSLLMCQGL
LWVGTSQGIILTFPLPTLEGIPKITGKGMTSLNAHCGPVDFLVSSSSTLDSFLNSSVEGA
NREAEGGRGGGAGDEELRKCEQRSLQQDSEASPPREEKPKRLLLQYRLHSTCQLPGKLLS
AQPEQGIHRPPTGCLEHSPEDCSIYEVSEDPDVWVRGRPVEWWKEGEVRRNKVTSTAIFS
GGRGHRRIGQMSSLGTCSASTENTLLVWQLPLTL
Download sequence
Identical sequences G3PGL6
ENSGACP00000016740 ENSGACP00000016740 69293.ENSGACP00000016740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]