SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016773 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016773
Domain Number 1 Region: 4264-4401
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.13e-33
Family Synaptotagmin-like (S variant) 0.00000632
Further Details:      
 
Domain Number 2 Region: 4629-4761
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-18
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 3 Region: 4068-4148
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000752
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 4 Region: 742-810
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000946
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.024
Further Details:      
 
Domain Number 5 Region: 280-337
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000109
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016773   Gene: ENSGACG00000012685   Transcript: ENSGACT00000016807
Sequence length 4767
Comment pep:known_by_projection group:BROADS1:groupXIX:16284897:16332087:-1 gene:ENSGACG00000012685 transcript:ENSGACT00000016807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEEDPTMFSSKFLSGANPLNAVSSAVNKFGLFGDDGDKNKKAPSQQGAKPGQQPGAGPS
LGPQQQQGIQKPGPTEKGQPLPKEGSPQLHGNGKAEPPIKPGGQHVAPKAGTQPEGPLKG
EPQQSQTKGPPQQGSPKAPQKVPPEAEMQQPGPAKTGMQQPGPAKTGMQQPGPAKTGMQQ
PGPAKTGMQQPGPAKTGMQQPGPTKTGVQQQGSAKTGVQQQGSPTIGQQSFRDTPQQQSS
KRPESQKQDPRGPTAPGMDRAGSSAPGPTKAGSQSRAVVKSLCPVCKTTELNVHSKDLPN
HKTCSHCKTEVCNLCGFSPPDSDQGREWLCLPCQIQRAQGGSEQQGPSTKKLTPNKVPSA
QNQTPSPAAPVKKEMLAPGSPKKRSHIPDKTSQSGRKQSCSQQESGGLFGLGGVKTEAAK
PDESVTASAVQDEPKSTPPVSPKIQSAKDNKPATVQKSAKEAPQQATANPARQIKGDKAA
FQSPKAEAAAHSSPKADTAKVPDSYKQASQSPGQKTPQDESKTTPPLSPKMNAAKDSKYH
TAKEGKPEQPQQAKRSPSVQPKRKPPPAGPPAKSEVIKGPKKQATKTAERPERETQASPA
PGRKTPIDIGGAPEPEASKPTESVSGKMFGFGSSIFSSASTLISSTVLDESRTTPPSSRK
MSAPVSPNRKLHSQFPPKCPTQSEKPEAASVPLKQTSPARNHKTPQEIQKAVLKKPPDQT
KTPPSTQTKVDKASFQLSKDGATSNATNKTSHSTCPLCKLELNMGSKDPPNYNTCTECKN
TVCNQCGFNPMPNVSEGKEWLCLNCQMQRALGASEPLGLPMIKPKSSQSKEAAATQKKET
PISTSQEDIHQPAAPKNSEVEKRHPQQPPETVISAPTADQEAEMPSPKQPSNALTTIAKS
TAPPDQHVEEQTPKQSSAPPDSEMEKLHPQQPLETVIFDPSDQEGEKPSLKQPPKAMTTI
TAVPPDQHAGEPTPKQPSKTVSSIAKSASPTDPEAEKLQLRQPSETVISAPPPYQHAPQR
DSMQAAKDTKPTAVKKTEEKQPEKRLQDKTPSNLQAKVDKGLPEASKKPIGKSPQVQLSQ
TPKPEDKSIGYTAVTKEVTHATTQKQGTPKVEAPVLIAVKQAETPHRDSVQETQILSGTE
QRQGKVVDDQQKPVGKTPQVQLSQTPKPEVSFGGPKAQPAAAKHAESVTGKMFGFGSSVF
SSASSLITTAVQVESKTTPPTPRKMSTTSSVSPKATPPTPQEKQPLAALTAEVMPPAKDT
ATLKAEVPNTDHNRTVTVEDREDFLVLVLVVFLQPQGQDEINKEPVKEVKVTIPTENKVV
TATATKPESKTVKEGAERRRLSFQAMAESSESEFTPSPKVQKRKLKVRNVSSSSEDIKSE
SADSSMEDEEFIRKQIMGMGDKEDIYPSEDEREKDLVDDETINIFELDKSSVTAKPLSRK
SSTENEESPVRRTTLPKALAEITQDISETIPCSTFKKALTVIRHRQSTDEEVESITESLS
KGSSSVQVSSFTPGSSPTSASSLEEDSDSSPRHRKICGEKQLRKGRHRQPTQPLPTIEDS
SEEEKIRGGEKPRKEKEELKSHGTSLFPTKDTSSTENLKQITTMDETSRSGSEYSASIES
EPEVWRSVQRGDKPSPTVIPYNLSDPFNEKHIVTSPLKSAEETYEEIIQKTKAIPGESPP
DIEPLYGGMSIEDYLYGSLVEEPEMKMGESPEDTSSECLKQLRSPEEVYEKMMQKKRELM
MIEQEFQQAQVAIASSSSGTSVTGPPLIAETCVVTITTEETSPTEQFDMLLPGTETSSEV
PVKRKKRPAPPRPTEPPKRSEVNVVLITPGGSIGFARPMVRQDPSLGKALFPIPDLKITR
CSSGEEEDDSLADDDDSETKEYPSISPPLSETTEMDPFCVVCEIPEPQPIPTPISALELT
TTPSPVSPLSPPTSPASPESSMASNATSSSSLQAQTPLSSDSTPLSTPTHPTLFVTQSPQ
DISPPSPSTIAKVPSTGASVSYPTLTKKPDLVSSPSQVPIVAPAVVQVSAQRPAPVVSAL
PPVLFTPVPVTVNNESSALVDIDSVTQASCPWTVKDQTMPDLVSTTSSISAQTPLPVSAL
VTSPTQGQTKVVHPFRTAILPVSPAPVQPAQGPVPSSASTIITKKKVPPPPPPRSTSVSI
PESNTYPSFPTNLTKPNVYPTPLVPSSVTIATAAQASYTTDSPSQTAKPPPPIPPKPISI
PAGLVFSHKPGESVKPPPPHVAPKAATLPRIKEPPNALSLSLTRPVESKFSATSPKSPMS
PRHSKCLQTYVVITLPSEPGSPTEVITVQAPTEVTLVAPLPQDRPAAVSTTVLNPQVAAQ
IKMPNQEQYLPTHGMVAELMPLTTVANPPESLPSLVTQVVTTEVQRTTVSVVHERLPQIP
QHSVAIAIQPDVAKVQALTKHNAKRIYPGDVVDLRTMKVDIKMTEQGMDLTPPESCRQSF
SSDCSGRQITAVQPEIVNLSAEITPATTLSVVTDSITIVACTATIASYNSTPAEKPLDLQ
GHVSSLPLPLTTYKPFEPLAQIVYRPVNTQPLVSAVVSAAQDLPINLSFGALVSSGGEQP
MTSPLSIRNQGAVLSLEATGAMDLSNYRPVRAMVALSDTSPGVVTTVVEDDGTPVDLTAG
SRIVCCDVIYKLPFTGSCRTQPPVTSQPDNRFGYGADHYQYDNAGLYGFQGMNGIKASTS
ETNLTEAELFSYDPRNDYDHLSRSSDGAMDLTAAKLSSGEYRVFNLYNYSPFPLIRQMHA
CASVCSLNILVLRLASQTDNRYACKALDYTSKSTGFYPGTIAAPVPSTNTITTQPGSIFS
TTLPPTTTVQNQSSPYPYGFIHSTDPGQIITFDTEIPKDLLPTALADIITGYPDMYSDTT
LEAIAASLDALASSPIFPGLDNTKMAQYQMEREFLELEKLKQLCLAEELEWERQEIQRYR
EQEQLMVQRELEELQALKQQLLMQQEEEHHAHMVAQQETYAQQKEQLQQIQQLQLQLQRQ
LDEHYGSTGHTGNFLDAKYAGVGDSGQYWPVKDESTVAIGTHLEESQDQFNIVKGIQAEQ
DAGKKIIDSGVQTDDEDSAEKQHVGRRKKNKRNVDCSAQTDDEDQDEWDAPTKARRRSRK
HSGDGKHGSKVSSIAIQTVAEISVQTDHSGAIKPPGVHMDTKVEIIKHISAPENSQRGGS
LSCQTESDRSVTPIEVGYSTHLRADVPLKSKVFYTSISPVSPEKSLGGQRMLTADPTRFS
SGPRMLKSSQKSLSDPKSLSPTTDDRMGGYYADSYSSRSSPSGTGRKVKRTLPDPPPEDD
SMAGRAGYNSNSARRRLARSTTMARAKILQDIDKELDLVERESYKLRRKQAELDEEEKEI
DAKLRYLEMGINRRKEALLKEREKRERAYLQGVAEERDYMSDSEVSNIRESRGDGLERPR
TAPQSEFDQFIPPQTEADSQYNTLTSPYSHYAQYVPQTQTTSHYTQQNLYQQQQSLYHQQ
ASPYTNLSLPHSQGQSSSYQHALLLQQGKQRRSTMSELEPKITTNYEVIHNQPLLIVPTS
TESVYGVAHLGDKYGSLDLRLGLGERSMASSPMSSISADSFYADIDNRNSRNYVLIEDIG
ELTKASTGQSNTGMGSGFNIPDKELSKADRLLRAAEVRRTAEVADFLGSSRLHSYGKAED
ETMEEPYELKLLKQQIKQEFRRGTEGLENLTGLGLPHHLPSDSSFRHFPKGEKYSIGRLT
LEKQAAKQLPAAVLYQKQMKNKKATIDPKAITKCSPIQESRDLEPNFNNYMGSGVSSVTN
LAATARLLQDEITFGLRKNLSEQQKYLGSSLGTNLAGSLNFGQSLGLGPAIRATAQDDGT
YPSGTRSRPSSRPSSRPSSVYGLDLSIKRDLSSSSLRLKTEGEVLDAAFAPGVARAKPTS
LPISQSRGRIPIVAQNSEEESPLSPVGQPMGMARASAGPLPPISADSRDQFGSSHSLPEV
QQHMREESRTRGYDRDIAFIMDDLQGAMSDSEAYHLRREDTDWFDKPREGDPQSGNTSDR
RQTVNLKCFLEVITFHHSVNSLKFQMKLVHYAFPHTCIKLKRDPKDTSVSGNGLGIRVVG
GKEVPGSCGQIGSYIAKVIPGGVAEQTEKVVEGMQVLEWNRIPLTGKTYEEVQCIMGQPC
AEAELCVRLDLNMLSDPEHPQALEHHVQLKAAGGQRSPGVDPKQLAAELQKVSQQLAPGM
CGAGLGTGDLSVLSALERSALLHSGTGSAASSGVPSPGQPASPAISKKQRHKKPIEAMRT
THLITGEIQLQINYDRNLGNLIVHVLQARNLAQRDNDGYSDPFVKVYLLPGRGQVMVVQN
ASADNKRRTRYAQKTMNPEWNQTVIYKNIHLEQLKKKTLEVTVWDYDRSSSNDFLGEVLI
NLSNTAQLDNTPRWLPLKEQSESIEHSKAHHGQGPAGSQDLPKNSVIKSRSHGIFPDPSK
DMQMMPLEKSHSSPGSSKSSSDGQLRSHGPSRSQSKSSVTQAHLEDAGIAIAAAEAAVQQ
SRLQPILHIYTVTKHKRTKHRHPKRFKSQQDAHSAANESKAPTRVMLRTLSSHSPLPPSG
PGHRLGDVSGSVVLSAPSLVGDAYGGLDGDEGTVIGVDSAIFQVPRIGKTIPNGTDKNQI
VTPENEGGKTQVMGEIKVALKKEVKTEGDQLVLEILQCRNITYKFKSPDHLPDLYVKLYV
VNVATQKRIIKKKTRVCRHDREPSFNETFRFPLNSTGHSIQLFLVSNGGKFMKKTLIGEA
YIWLDKVDMRKRVVSWHKLFVSSTQTN
Download sequence
Identical sequences G3PGP8
ENSGACP00000016773 ENSGACP00000016773 69293.ENSGACP00000016773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]