SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016778 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016778
Domain Number 1 Region: 2654-2695
Classification Level Classification E-value
Superfamily UBA-like 0.00000000866
Family TS-N domain 0.063
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016778
Domain Number - Region: 3636-3764
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000471
Family Ricin B-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016778   Gene: ENSGACG00000012683   Transcript: ENSGACT00000016812
Sequence length 4395
Comment pep:known_by_projection group:BROADS1:groupXII:16770249:16813525:-1 gene:ENSGACG00000012683 transcript:ENSGACT00000016812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEGLVAWVLNTYLGKYVSNLNTDQLSIALLKGAVELENLPLRKDALREFDLPFEVKAGF
IGKITLQIPFYRPHSDPWVISMSQLNLIIGPAHQQEYDGEKERGEERERKACLLKALEDK
FKSEREQKGESYWYSVVTRIVENIELKIQDVHLRFEDDSCNAEKPFSFGVCINNISAQNP
SKETVQKLLRQKQLEISDFSVYWDTQCEILGKLPANQIQDAMTRCMQSREHQYIFEPVCA
SVLLRRNTSKEPLRSRHTPRIEGQVQLQPMCLRMSQVQYQQIMAFLKEVDRREREMLYRK
WRPKVPISGSCRQWWMFAIQANLSEIREQRRRSSWGFALQRARDAQTYTGLYFARLKGAP
LTSQEESELERVEEEQTLEELQCLREIVHDWFRKQEEISEYVREPSSDSQPCLATTSIPK
SGSSGMIQYLQSWFPGWGGWYGDSQDPDRPDELLPSPSSWDILETEDLFDPLEDSHTLNT
FTRRDHLFARLEFLLEKGGVTLSHQDRRGGALHESGVIQLEFSGVNVILESLPRSESSLL
SVKLGGLFLRDLTTQGTIFPVLVSPKTDKVVVAMNQPSGQSTSSTVKHHLKQCSPSPVFE
MIYERNPVRCKFERRLEVNTSPLNIIYNPQAIKKLTEFFYKGRVHTSGFGYQSELELRVA
EAARRQYNKLKMQTKAEIRQTIDQLLVGEFIENGKRWTMKLDICAPQVIFPDDFQSEDPM
LVVVDLGRILLTNCQEETKANSKAAEPEREDMSDDEYQTPLATPPESPAPELDMPLKEQL
KSSNLPSLRSPESTQAYCRKLYEKYSLSFKDLQIMVGRYKDNWKHLQESEVGPTHVVEKF
NVLLQLEQRLRYTSDPQLPGAVLSGTLPDLKVHINLEKMTALRSCLARLSTPSFSEDNKS
QEDKIFQREDSSWKLQGSAKNLTHSVMTLEQHTREVLVESRLLLAEFNINYMQLGVESDG
RYISVLKVFGTNAHFVKRPYDAEVSLTVHGLLLVDTLQTYGSDFDLLVASHKNLSFDIPT
GSLRESQPSSPVSSDGRSPDHQGHHTGLSSGMPMDKISPFSSFLKDQEALIKLEYQFVSS
DCPSMNLDSSLQVTSMQVNNLDIILNPETMVELLKFLQKSFPKEESTWTPSVPQPTAQHS
SEEEEGTYQATYDQNKELTVEIHRLNLLLLRTVSTGTVLGAEKKGLKIATASITGTKVNV
SMGSRLDINGSLGSMQLVDLTQEGGRSQFVVSIGSADSPSTLGGITFLADTGGSPSDALD
FRLMEKSQGECSLQLQMASLHYNHSAKFLKELSLSANEVEDNFRSMLKSAATKVSTVLVT
KTAEYSGMVSLFETPSRRTRTQSQSWPYPFEEEEEDLPTEEPESALDTFLVKLTLNISIE
SPVVSIPRKPGHPELLVGHLGSITIQNFVTGQDSEGERLQVLVKDIRLYSVNMSHLVLKR
ALRGDTAGGMSPSRSGSINQDEPQFTRHDFFEFLSRGKAFHILKDTTIQFTLEKVPVDED
TQFSFLTAEEPCKSTGLLRIEGKFINPVQVFLCKPVYEQVLQTLDNLSLIEEQRVTPSQP
PTPPPPTPSSTRPHRFPDPQGGLFAKDPPYLSFSHTSLSSPLPLQSHQPALHNSFTQLKI
TLHVAELQVQLSADLSQGSQGLVSLRFQDLEGEFTKDHPQLLTVQLALRSLLMEDLLEQN
PESKYKHLMVSRGAPKPSTFSPKEYLSQSCPSASNALFPDMPRSLPAHMEEARNVFQLYQ
RHPSTPSASSRRSKRDPECPSTPPPSPTHHAPSPQPPPDFDESLVHINVMLVDQNHPEFK
TRYGRVGRSVDVDFNCLDVLITLQTWVVILDFFGIGSTANNHAVKVPPTAPHAEPGHPLY
EPCLSEEETTEAVNTKVDVKVHSLSLVLNKKLNELARASVSKLSAHLEMLDGDLALQGSL
GSLSLSDLTPHGDLYRERFTTQGGEALIFNILKYGRPDAALERECDIKVSLQMASVQYVH
TQRFQAEVVAFIQHFTQLQDVLGRQRAAMEGQAVRNVPQRASRVLLDIEAGAPVIVIPES
SCSPRVIVANLGQLRVQNCFLPAGAHGTFSLRDKVEKLTMAHAFFPSLSWKRSESRKQQR
KVSGKSRRRPRPPPLQGLPWAGHRSQTRGRPLRGTKPTAQVSVAAWSEEDVCLLDCIALD
LQEMDIFAAECLPSQPRDSGGKPPESSDLIFPSYSVRRTGDNLLKDRCRLKLKVERNLDK
ELSHVVPDMSIHGSLSSVHCSLDLEHYQLIRGLLENNLGEPVEDFLRPYNLQDPSTYTVL
SGDVYTSLSFLVDMMDVSLELLDSPTPTEHKRSLARFDFMKSKLLFESLSNGSKSINLVS
HSLLAYDTRRSEPSKSPGKAHRERHNVFDCILQPSKTGTNRATLQLELHYRSTRDSSCFT
VVLNNLRVFLIFDWLQLVRNFLRVPVEKVSRAAEPRQRCPSNASTDSGSAPAGTVGAVMP
KTVKSGVVTKRSTVPVNQDHCLEIKINVTGTEFVVVEDSSCLDTNAIILKGTTVLTYKPR
LLDRPFSGSLAGIEVFSCRLGSELETALSIIDPVNIQVELCGSPTYQSSSGLLDAFNVED
IPPLLEIQFPSLDIRLSYNDIQLFLAITKSIPTSGSAPPSDCDSRPAASTEPTTAKDSFR
QKTEALIGTRRPVIEGQLTRLQDLGFRKEDCKRALIHCKGQLDQAATWLLENADNMAGLG
RSRTDSGSSCHSAPLSGVEVKAESVCICLIDDCLDCDIPLAELTFSRLYVLQRIGSTQEG
KASFTLSGDYYNRELSGWEPFIEPWPCSLSWQQQAAGRLHPPRLKMGVRAKQRLDINITS
VLLEQYNTTKSAWIADYCKEEEHTPQPSPPPPWMGSSVDPPSVGQSAPLAPLRTRSTDTL
TCPEQQIHSGADVKLSKRRQPFVPFALRNHTGCTMWFATLTTTPTRVALSHSSSADSISD
VHGPGTDDTHNISQWREVQPGEEIPFEFEAREKLRHRHTHELKLHQLLVRVCGWEQVKPV
SVDKVGVFFRYAAPDRNNSSSTVGSPISRTNIIHPHVYFSALPPVRVVFSITMEGSARKV
VTVRSALMVKNRLDVPMEVRLDSPSAPDKPVVLPPILPDQALAVPLHLTSWRLQARPKDL
GLFFCKVPIHWTSVERPGDISSSKRECQSADFDDSLKRSFRFCVVIKKENYPNQQPAKTV
SGSAKQIYRQPGHTIYLLPTMVLANLLPCDLNYFIKGTAIRGALKPGKEAVLHVADTSQN
MELGVLLESFPVCKELLIPPGTQNYVVRMRLYDTNKHLLCLTIRIVLRAQGALKILISAP
YWLINKTGLPLIFRQDNGKADAAGQFEEHELARSLSPLLFCYTDKEQPAMCTMRIGKGIH
PDGVPGWCQGFSLDGGSGVRAVKVIQHGNRPGLIYNIGISVRKGKGRYRDTHIVTFAPRY
LLDNRSTHKLAFAQREFARGKGTTNPEGYISTLPGSSVVFHWPRNDYDQLLCVRRMDTPN
CTWSGGFEVNKPKSFHVNMRDTLGSCFFLRTEITLKGATYQISFSDADQLPPPFRIDNIS
EVPIQFWQHSVADIRLHTEVKAGSVLDYACDEPTLPPYLTLTVKGAGSSEVTSDMNFFRE
YNKLYYENFIYIAATHTFSLDFEKRPVGKKRLVSCAELVLDVDTKTQRVILKKKEPGKRS
QLWRMTGSGMLCHEGSSPPQSKPAQPRPLDSSLVLDIAGLAAVSDNSFEPVMLRRPDSRR
STTQTWYFSSGMLTCGLPRLVVQVKGGTAGLYDGAEVVLGPDSGLQEPGPEQQFINQKMR
PGSGVLSVQVLPDGPTRVLQISDFNQRRMIRSSSSSEQEKAKEDEKNREPEQELEVLVNL
EEGVGVSLVNKVPEELVFTTLSGIDVHFTRTAANEVLELSIQNIQVDNQLLGTTQPVMLC
VTPSSSDSGLSDSGPALQVNSVKVPSSLMLTDLFKHLMVTARRFTVIIEEKLLLKLLSFF
GYGQTEAELEKLDENVYERPNEDAGPPKRYYFENLKISLPQVKLSVFTSHKLPPDLKVLK
GTLGFPLVRFEDAVINMYPFTRVHPYETQEIIINDILKHFREELISQAAQILGSVDFLGN
PMGLVNDVTEGVSELIKYGNVGGLIRNVTHGVSNSAAKFAGTLSDGLGKTMDNRHQSERE
YIRYHGATSGEHLVAGIHGLAHGIIGGMTSIITSTVEGVKTEGGVGGFFSGLGKGLVGTV
TKPVAGALDFASETAQTVRDMASLSNHRLSVQRVRKPRCCKGPQGLLPRHSASQSDGQEQ
LFRLTDNIHSEFFIAVEPIDSYCVLISSKVVYFLRPGDYVDREAIFLEVKYEDLYHCLVS
KDHGKVYVQLTKKAESTSSGVAIPGPSHQKPMVHVKSENLAVKISQEINYAKSLYYEQQL
MLPVNEDEDCLLLEF
Download sequence
Identical sequences G3PGQ3
ENSGACP00000016778 69293.ENSGACP00000016778 ENSGACP00000016778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]