SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016803 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016803
Domain Number 1 Region: 7-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.17e-16
Family Ubiquitin-related 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016803   Gene: ENSGACG00000012718   Transcript: ENSGACT00000016837
Sequence length 365
Comment pep:known_by_projection group:BROADS1:groupXX:14449322:14453349:-1 gene:ENSGACG00000012718 transcript:ENSGACT00000016837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDSWAVNSPVTLVIKAPTQKYGDQPICFLNWTVRRLRSHISNVYPSKPELSKDQRLVYSG
RLLQDHLQLRDVLRKQDEYHMLHLVCASKSPPASPMPRSAAVAGSDASSSDTPHASQPSP
SPSPSSSTSVPGSYDGLRYRGGIPQYNPQGPAGVPQWPDAAQVPLQGNMPPHPMYMPMQM
LWWQQMYARHYYMQYQAAVAAAPQPNEAVQPPLGPNPAPNPLPENQPANPIQMNAQGGAV
LNDDELNRDWLDWLYTVSRAAVLLSIVYFYSSFSRFAMVVGAMLLVYLHQAGWFPFRPEQ
QNGRHQDIQEMERLMDEGMEDMAGGAGHRDPAAVVHDPGFLATAWSFISTFFTSIVPEGR
HQPAN
Download sequence
Identical sequences G3PGS8
ENSGACP00000016803 ENSGACP00000016803 69293.ENSGACP00000016803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]