SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016865 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016865
Domain Number 1 Region: 318-637
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.07e-125
Family Mammalian PLC 0.0000000109
Further Details:      
 
Domain Number 2 Region: 160-314
Classification Level Classification E-value
Superfamily EF-hand 1.04e-44
Family EF-hand modules in multidomain proteins 0.00015
Further Details:      
 
Domain Number 3 Region: 646-771
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.4e-32
Family PLC-like (P variant) 0.00012
Further Details:      
 
Domain Number 4 Region: 38-149
Classification Level Classification E-value
Superfamily PH domain-like 1.36e-25
Family Pleckstrin-homology domain (PH domain) 0.0000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016865   Gene: ENSGACG00000012708   Transcript: ENSGACT00000016899
Sequence length 774
Comment pep:known_by_projection group:BROADS1:groupIII:245587:251038:1 gene:ENSGACG00000012708 transcript:ENSGACT00000016899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCLRGRPKASPAEEMLRRARGQKVVEMNEKLLGMKGDPDLHFLLQGGDLLKVRSSSWKK
TRHFRLMEDCKTMWRESRKMFKNSKTFSLDDVSAVRMGRQSEGLRKNTEELVEGRCFSIM
FKGSRKNLDLIASSEEEAKRWVSSLQTVISNRGNLNRLQKTEHWIFNCLRKADKNEDDQM
SQSELKDFLRLINVEVDDEYAEMLFQKCDKSKSGYLAGEEIEHFYKLLTHREEIDVIYGE
YAKATGFMSPQNLVDFLIKEQREAATLADAHNIIQKHEPDENAKEKKLLSKDGFLMYMHH
PEAMVLNPDHREVYQDMSQPLNHYFISSSHNTYLMEDQLTGPSSTEAYVRALLKGCRCVE
LDVWDGSDDEPVIYHGYTLTSKILFKDAIKSIKEYAFKTSDYPVILSLENHCSVAQQEVM
ADHMSSILGSALVTAPLGGGMPTDFPSPEELKGKFLIKGKRLNKLEASFAAADDADVTEE
DEANNGDKDELKEEEKKKEKKKLKLAKALSDMVVYCKSVHFNGFEDARRNLSFYEMSSFK
EPNAMALVEDSANSYIRHNVDKLSRIYPAGSRTDSSNYSPVPLWNAGCQIVALNFQTSCT
DMDVHQGRFLVNGKSGYVLKPAFMRNEATEFDPITLTQGPWLKHKTLHVMVISAQQLPKV
NQKKTSIVDPLVRVQVYGVPADVAEKATTSVANNGFNPAWNENFQFDVYVPELALVRFTV
EDHDSMSANDFVGQYTLPFESLKMGYRHVPLLGKNGDPLPSSGLFLHIMVLDVE
Download sequence
Identical sequences G3PGZ0
69293.ENSGACP00000016865 ENSGACP00000016865 ENSGACP00000016865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]