SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016910 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016910
Domain Number 1 Region: 435-675,707-777
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.83e-57
Family Diacylglycerol kinase-like 0.02
Further Details:      
 
Domain Number 2 Region: 5-99,128-155
Classification Level Classification E-value
Superfamily EF-hand 2.37e-36
Family EF-hand modules in multidomain proteins 0.0035
Further Details:      
 
Domain Number 3 Region: 130-221
Classification Level Classification E-value
Superfamily EF-hand 1.47e-17
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 4 Region: 225-295
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.08e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0029
Further Details:      
 
Domain Number 5 Region: 298-362
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000464
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016910   Gene: ENSGACG00000012786   Transcript: ENSGACT00000016944
Sequence length 803
Comment pep:known_by_projection group:BROADS1:groupXX:14572594:14617822:1 gene:ENSGACG00000012786 transcript:ENSGACT00000016944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGQEKWVTLTPAEFALLQEYTQYSTKKLRDVLQEFHGDGVLAKYNPEEKQDILSQDIDF
EGFKVFMQTFLESELPEEFCRHLFMTFSNKGPEPGPSSSDKPRVSAAGLKLIKGSSTPLR
TASPPPPLETVQLKDIVCYLSLLEGGRPEDKLEFTFRLYDTDGNGSLDSSELEHIISQMM
HVAEYLEWDVTELKPVRHPDMMQEIDYDHDGTVSLEEWIQGGMTTIPLLVLLGLETNVKD
DGQHVWRLKHFNKPAYCNLCLNMLIGLGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKT
KKNPEVMHHFWVEGNCPTKCDKCHKTIKCYQGLTGLHCVWCQITLHNKCASHVKPECDCG
PLKDHILPPSSICPVVLCWKSPHARVRGLTFDPQERQSTLRKDSRCSQSSRGKMQRANSV
TVDGQGLQITTIEGTHPLLVFVNPKSGGKQGDRIYRKFQYLLNPRQVYNLAKNGPMPGLN
FFRDVADFRVLACGGDGTVGWILDFIDKANLDRNPPVCILPLGTGNDLARCLRWGGGYEG
ESLLKITRDIENSSEMMLDRWKIDVTPADKEERGDPVPYSIVNNYFSIGVDASIARRFHV
MREKHPEKFNSRTKNKLWYFEFGTSETFSATCKKLHDFLEVECDGVTLDLSSISLEGIAI
LNIPSMHGGSNLWGESKKRRGNRKGGKKSQDKRTPVLDPKELTFAVQDLSDHLLEVVGLE
GAMEMGQIYTGLKSAGRRLAQCSSVTIRTSKSLPMQIDGEPWMQTPCTIEIVHKNQAPML
IGPPQCRSFLSSVIRRTRSESKD
Download sequence
Identical sequences G3PH35
ENSGACP00000016910 69293.ENSGACP00000016910 ENSGACP00000016910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]