SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016926 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016926
Domain Number 1 Region: 76-399
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-81
Family Protein kinases, catalytic subunit 0.00000238
Further Details:      
 
Domain Number 2 Region: 961-1029
Classification Level Classification E-value
Superfamily G protein-binding domain 2.3e-27
Family RhoA-binding domain 0.00015
Further Details:      
 
Domain Number 3 Region: 1139-1227,1313-1343
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000148
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 4 Region: 1248-1297
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000133
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016926
Domain Number - Region: 417-529
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00186
Family Myosin rod fragments 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016926   Gene: ENSGACG00000012788   Transcript: ENSGACT00000016960
Sequence length 1379
Comment pep:known_by_projection group:BROADS1:groupXV:13331130:13353061:1 gene:ENSGACG00000012788 transcript:ENSGACT00000016960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGAERRMEARLKKLEDMIRDPRCAINLESLLDSINALVLDLDYPALRKNKNIETFLIR
YEAVIKQTRDLQMKSEDFDRVKVIGRGAFGEVQLVRHKASQKVYAMKVLSKFEMIKRSDS
AFFWEERDIMAFANSPWVVQLCCAFQDEHYLYMVMEYMPGGDLVNLTSTYDVPEKWAKFY
TAEVVMALDAIHSMGFIHRDVKPDNMLLDRLGHLKLADFGTCMKMNSTGMVHCDTAVGTP
DYISPEVLKSQGGDGYYGRECDWWSVGVFIFEMLVGDTPFYADSLVGTYSKIMDHKNSLN
FPDDVEISKDAKNIICAFLTDREVRLGRNGVEEIKRHPFFKNDLWTFDTIRDTVAPVVPE
LSSDIDTSNFDEIEDDKGDVETFPKPKAFVGNQLPFVGFTYFKEDQSGMNASNNVLVTHD
DSKGESAALQKKLRHLEVQLNNEKQVKGDLESKHRAATSRLDKISKELEEEVSGRKKLEA
ALRQLEREKALLQHKSLESSRKAEGEADRKRCLESEVSSLRDQLDDMKKRNQNSHISNEK
NIHLQKQLEEANTLLRAEAEAATRLRKTQTESSKQLQQLEANVRELQDKSCLLERSKLSL
EKECISLQAALEAERREHSQGSETISDLMGRISSLEDEARQQRQTLSKTETEKRQLQEKH
TDLEKEKSNKEIDLTYKLKVVQQELEQEEASHRATRALLADKSKIKVTIEGAKSESMKEM
DQKLAEERAAKLRLENRILDLEKHSSMMDCDYKQALQKLDELRRHKDRLTEEVKNLTLKI
EQETQKRSLTQNDLKAQNQQLNSLRTSEKQLKQEANHLLDIKRSLEKQNQELRKERQDTD
GQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKNKLHKDAQQSLQELQEERDSLAAQLE
ITLTKADSEQLARSIAEEQYSDLEKEKIMKELELKEMMARHRQDLSEKDITIGSLEEANR
TLTSDVANLANEKEELNNKLKEAMEESEKSKDWEQQISQMKQSFEKQLQSERTLKTQAVN
KLAEIMNRKELRGGGSRRGNDTDMRRKEKENRKLQLELRSEKEKLNSSIIKYQREINEMQ
AQLSEESQMRIELQMALDSKDSDIEQLRNLLQSLSVQSMDSASVCSGPEFDTDDAFTEMR
LEGWLSLPVRNNTKKFGWERKYVVVSSKKVLFYNNEQDKEQSIPYMVLDIDKLFHVRPVT
QTDVYRADAKEIPRIFQILYANEGESKKEPEFPVDPLPIGEKSSYICHKGHEFIPTLYHF
PTNCEACTKPLWNMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKAVNYDVSSAKNLLL
LAVSQEEQQKWVSRLVKKIPKKPLPPEQFARSSPRASMKVQPSQSMRRPSRQLPISKSR
Download sequence
Identical sequences G3PH51
ENSGACP00000016926 ENSGACP00000016926 69293.ENSGACP00000016926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]