SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016931 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016931
Domain Number 1 Region: 43-368
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-81
Family Protein kinases, catalytic subunit 0.00000238
Further Details:      
 
Domain Number 2 Region: 926-994
Classification Level Classification E-value
Superfamily G protein-binding domain 2.22e-27
Family RhoA-binding domain 0.00015
Further Details:      
 
Domain Number 3 Region: 1104-1192,1278-1308
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000014
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 4 Region: 1213-1262
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000127
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016931   Gene: ENSGACG00000012788   Transcript: ENSGACT00000016965
Sequence length 1344
Comment pep:known_by_projection group:BROADS1:groupXV:13341028:13353061:1 gene:ENSGACG00000012788 transcript:ENSGACT00000016965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSINALVLDLDYPALRKNKNIETFLIRYEAVIKQTRDLQMKSEDFDRVKVIGRGAFGEVQ
LVRHKASQKVYAMKVLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLCCAFQDEHYLYM
VMEYMPGGDLVNLTSTYDVPEKWAKFYTAEVVMALDAIHSMGFIHRDVKPDNMLLDRLGH
LKLADFGTCMKMNSTGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFIFEM
LVGDTPFYADSLVGTYSKIMDHKNSLNFPDDVEISKDAKNIICAFLTDREVRLGRNGVEE
IKRHPFFKNDLWTFDTIRDTVAPVVPELSSDIDTSNFDEIEDDKGDVETFPKPKAFVGNQ
LPFVGFTYFKEDHALSHTQTHKQLLVLQHASAALQKKLRHLEVQLNNEKQVKGDLESKHR
AATSRLDKISKELEEEVSGRKKLEAALRQLEREKALLQHKSLESSRKAEGEADRKRCLES
EVSSLRDQLDDMKKRNQNSHISNEKNIHLQKQLEEANTLLRAEAEAATRLRKTQTESSKQ
LQQLEANVRELQDKSCLLERSKLSLEKECISLQAALEAERREHSQGSETISDLMGRISSL
EDEARQQRQTLSKTETEKRQLQEKHTDLEKEKSNKEIDLTYKLKVVQQELEQEEASHRAT
RALLADKSKIKVTIEGAKSESMKEMDQKLAEERAAKLRLENRILDLEKHSSMMDCDYKQA
LQKLDELRRHKDRLTEEVKNLTLKIEQETQKRSLTQNDLKAQNQQLNSLRTSEKQLKQEA
NHLLDIKRSLEKQNQELRKERQDTDGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKN
KLHKDAQQSLQELQEERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELELK
EMMARHRQDLSEKDITIGSLEEANRTLTSDVANLANEKEELNNKLKEAMEESEKSKDWEQ
QISQMKQSFEKQLQSERTLKTQAVNKLAEIMNRKELRGGGSRRGNDTDMRRKEKENRKLQ
LELRSEKEKLNSSIIKYQREINEMQAQLSEESQMRIELQMALDSKDSDIEQLRNLLQSLS
VQSMDSASVCSGPEFDTDDAFTEMRLEGWLSLPVRNNTKKFGWERKYVVVSSKKVLFYNN
EQDKEQSIPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEPEFPVD
PLPIGEKSSYICHKGHEFIPTLYHFPTNCEACTKPLWNMFKPPPALECRRCHIKCHKDHM
DKKEEIIAPCKAVNYDVSSAKNLLLLAVSQEEQQKWVSRLVKKIPKKPLPPEQFARSSPR
ASMKVQPSQSMRRPSRQLPISKSR
Download sequence
Identical sequences G3PH56
ENSGACP00000016931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]