SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016932 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016932
Domain Number 1 Region: 16-167
Classification Level Classification E-value
Superfamily EF-hand 1.38e-42
Family Calmodulin-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016932   Gene: ENSGACG00000012814   Transcript: ENSGACT00000016966
Sequence length 170
Comment pep:known_by_projection group:BROADS1:groupXI:12484952:12487885:1 gene:ENSGACG00000012814 transcript:ENSGACT00000016966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNKQACIFLRGGTRRRTRELTKEEIGELREAFVEFDKDKDGFITCKDLGNLMRTMGYMP
TEMELIQLSQNINMNLGGRVDFEDFVDLMSPKLLAETAGMIGVKELKDAFREFDLDGDGA
ITSDELRQAIIKLLGEQTSKTEIDAVVREADNNGDGKVDFEEFVKMMSQK
Download sequence
Identical sequences G3PH57
69293.ENSGACP00000016932 ENSGACP00000016932 ENSGACP00000016932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]