SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016936 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016936
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.7e-18
Family Ubiquitin-related 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016936   Gene: ENSGACG00000012791   Transcript: ENSGACT00000016970
Sequence length 133
Comment pep:known_by_projection group:BROADS1:groupXVIII:14518550:14520102:1 gene:ENSGACG00000012791 transcript:ENSGACT00000016970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLFLRAQNTHTLEVTGQETVGQIKAHVQGLEGLLVEDQVLLLAGCPLEDDATLASCGVS
ELCTLDVAGRLLGGKVHGSLARAGKVRGQTPKVEKQEKKKKKTGRAKRRIQYNRRFVNVV
PTFGKKKGPNANS
Download sequence
Identical sequences G3PH61
ENSGACP00000016936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]