SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017049 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017049
Domain Number 1 Region: 10-121
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000123
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017049   Gene: ENSGACG00000012904   Transcript: ENSGACT00000017083
Sequence length 296
Comment pep:known_by_projection group:BROADS1:groupI:16595513:16598781:-1 gene:ENSGACG00000012904 transcript:ENSGACT00000017083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAGMSTAGVHRGFLRKYGGFVFKQWKEKYLVLTMEGSLLVCRDAESPPDQVVALQTLCE
SIAEGREILDLPRLPPGGRRDCCFALILPQNKFLLLLTENPDDCNLWLNMIRKVREGVMS
PFTLQRQCSITPCITDRDPLPDPPSSKDPGSPRVGEGTPPPSSRVTERGGSFRDGGQSQA
GGPRRPLRSVSGAPPHRVSDCLRHGNSSDARAVRAVCLLMGGAAASSALGYLNSSPSSPL
ASRAPDIGHGVGGFSELPAGGSFSACSQDVDSPNFNSFDFEGDSDFDAFDCGGFAF
Download sequence
Identical sequences G3PHH4
ENSGACP00000017049 69293.ENSGACP00000017049 ENSGACP00000017049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]