SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017070 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017070
Domain Number 1 Region: 211-288
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.42e-24
Family PHD domain 0.00062
Further Details:      
 
Domain Number 2 Region: 433-657
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.000000000017
Family Hect, E3 ligase catalytic domain 0.016
Further Details:      
 
Domain Number 3 Region: 140-199
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000377
Family PHD domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017070   Gene: ENSGACG00000012915   Transcript: ENSGACT00000017104
Sequence length 665
Comment pep:known_by_projection scaffold:BROADS1:scaffold_247:41916:48480:1 gene:ENSGACG00000012915 transcript:ENSGACT00000017104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNGKANSSSENLSCALCRLCDDDPALLGEKVTLKDHNLCVHYFCLLTSCGVYQRGKEDEG
VFGFLVDDIKQEVRRSARLVCSGCKKKGACVGCSVRRCRRTVHFPCGRRRDFLSQFTGLF
PSFCPDHSPTQTALGGPDLSPPRSCSVCLDPLDPVLSFSVLKCPSCHSSWFHRDCVQRQA
HSAGLFFFRCTLCSNQKDFQEEMLRMGIYIPERDASWELEANAYSELLEVYTRCDALVCL
CSDGRTHSAKTGWFQVIRCQLCGSRGTHRKCWGLKLDARDWACSDCTEDAEETEILFYVN
HGLLFSSFHGYVSSGRTEESPVQTPLVPHQLFDSCMTPPPLRAALPVGAGPPEGILQSLG
LQLCPLSMWVEVDGDQALSAGVELVRRADFDPTRTLSVCSLQDGDAARQYFLELLVQQIQ
DSVVFEGPDGSKNLALDSQALRDDLYLDVGCLLALSLAHGGPPVGFFSPALYRCLFNYPP
GPPLGLTHMTPGTLCTRRVGRIAEAESVEELREAALGSRELLELAGCSRPIGSLEEKEAL
VEDLVRFTMVTRMQLPLQRFREGLQTLGVFDQVQRLPSVFHSVFCEAEVHLSAQTLHQLF
SIHFSPQEDRRSRETPVSSFWRRFLQDCEVGRSSVSLKDLLRFATGTEELPAAGGLPSPS
ISFLH
Download sequence
Identical sequences G3PHJ4
ENSGACP00000017070 ENSGACP00000017070 69293.ENSGACP00000017070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]