SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017135 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017135
Domain Number 1 Region: 21-162
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-53
Family Ran-binding domain 0.000000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017135   Gene: ENSGACG00000012952   Transcript: ENSGACT00000017169
Sequence length 225
Comment pep:known_by_projection group:BROADS1:groupXIII:15432276:15435753:-1 gene:ENSGACG00000012952 transcript:ENSGACT00000017169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPKDQEDHETTAENAEESNHDPHFEPIVSLPEQDVKTLEEDEEELFKMRAKLYRFASE
NDPPEWKERGTGDVKLLKHKERGTIRLLMRRDRTLKICANHHIVPTMELKPNAGSDRAWV
WNTLADYADESPKAELLAIRFLNAENALKFKGKFDECKEEVRKSLEGTGDPDSANKVAEK
LEELTVKDKASDDKKEVQKVTEKKEDEKKENTAEFISFSFFYNRL
Download sequence
Identical sequences G3PHQ9
ENSGACP00000017135 69293.ENSGACP00000017135 ENSGACP00000017135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]