SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017143 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017143
Domain Number 1 Region: 46-460
Classification Level Classification E-value
Superfamily Ras GEF 9.02e-91
Family Ras GEF 0.00076
Further Details:      
 
Domain Number 2 Region: 532-596
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000643
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 
Domain Number 3 Region: 457-527
Classification Level Classification E-value
Superfamily EF-hand 0.000000157
Family Calmodulin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017143   Gene: ENSGACG00000012966   Transcript: ENSGACT00000017177
Sequence length 616
Comment pep:known_by_projection group:BROADS1:groupI:16700644:16706717:1 gene:ENSGACG00000012966 transcript:ENSGACT00000017177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGRLPIVTRCRQTLLKKPNGEGRKLVQRRRNTCPSPQDITRALQSPSSAPSASAASLDEL
IQRCLNCFDSEGKLFTPKGTRLVQMTLMMHSWVVPSQMFAQKLLALYKDCPSDKRGPKRT
QICQLIRQWISQFPAVFEADPLLEQTMGDLWALVRSDGEETQLIDTSCFFFFLFPRGPHG
NIFQAPSPSVKKRKVSLIFDHMEPDEMAEHLSYLEFKNFCNVSFLDYRSYVVRGSVRDNP
ALERSVMMCNGVSQWVQLMILSRHTAQQRAQVFTKFIHVAQKLRALQNFNTLMAVTGGLC
HSSISRLKDTSNLLPPDITKALSEMTELLSSRSNYVNYRRVYNVCSGFKVPILGVHLKDL
ISLNEALPDYINEEKINLSKLEHLYSNISDLVALHSCTPPFEANKDLLHLLTLSLDLYYT
EDEIYELSYTKEPKNTKIQPVAPVKAPVVAEWGSGVTPRLDPDTISKHVKQMVDSVMKNY
DQSQDGYIALEDFEKIASNFPFSFCTHETDREGQISREEITSYFMRGMSICAKLGFNFNA
HNFHETTYKRPTFCETCGGFVSVGCLWGVIKQGYHCKDCGINCHKHCRDLVGIACLKKHK
NTTGSCPCTPGPNPRT
Download sequence
Identical sequences G3PHR7
ENSGACP00000017143 69293.ENSGACP00000017143 ENSGACP00000017143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]