SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017208 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017208
Domain Number 1 Region: 688-951
Classification Level Classification E-value
Superfamily PP2C-like 1.06e-42
Family PP2C-like 0.0032
Further Details:      
 
Domain Number 2 Region: 400-686
Classification Level Classification E-value
Superfamily L domain-like 6.8e-42
Family Leucine rich effector protein YopM 0.014
Further Details:      
 
Domain Number 3 Region: 168-392
Classification Level Classification E-value
Superfamily L domain-like 1.09e-33
Family Ngr ectodomain-like 0.069
Further Details:      
 
Domain Number 4 Region: 57-160
Classification Level Classification E-value
Superfamily PH domain-like 0.00000197
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017208   Gene: ENSGACG00000013009   Transcript: ENSGACT00000017242
Sequence length 1234
Comment pep:known_by_projection group:BROADS1:groupIII:490991:521391:-1 gene:ENSGACG00000013009 transcript:ENSGACT00000017242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLYVQLHGEAVRRLSPDERPLQIQNDFLFKLGFKDPWRVQEEGLNTEIGSLLRFYAGKPQ
SIESSERVQLSGTYNVRKGKLQLPVNRWTRRQVILCGTCLIVSSVKESQTGKMHILPLIG
GKVEEVKKHNHCLAFSSAGPQSQTYYVSFDSFTEHLRWHRQAAKVMVSQRINSVDLSCCS
LEQLPPNLFYSHDLTHLNLKQNFLPADQRLQQLQRFSRLRSLNLSNNHLGQFPHAICDIP
TLTEVNLSCNYLTCVPGSVGAMANLQTFLLDGNGLAELPVELGSLQRLTYLGLSFNQFHH
VPQVLEQLAAMEKLCMAGNRLDTLTLQNFRLLRVKHIDLRLNKISSVVADEPDLLRHVTQ
LDVRDNRLTHLDASVFPRLEVLHCERNRIASLRAKGSLLKGVYAANNELRQLDISPVPSN
LTYMDISRNRMESLPDWLCEAKKLEVLDMSHNLITELPARLFCSNSLRKLSAGHNQLQKL
PERVERPLLEILDVQHNQLVELSSNLFLKSDSLRSLNASANKLEHLPPSSLSEESNSILQ
ELYLTNNRLTDKCVPLLTGHTHLRVLHMAYNHLQTFPASKMAKLEELEEVDLSGNLLKTV
PTTIMNCRRMHTLIAHSNAIEVFPEVMQLMEILQCVDLSCNELSDITLPENLPPKLQELD
LTGNPRLNLDHKTLEQLNNIRCFRIDPPPTFSSNEASGGPAVWSHGYTEASGVKNKLCVA
ALSVSSFCGSREALYGVFDGDRNVEVPYLLQCTMNDVLAEEIHKTKSEEDYMIHTFLVMQ
RKLGTAGQKLGGSAALCHIRHDPTDPSGCFTLTAANVGKCKAVLCRDGKPLSLSLLHNVG
LEEEYRRVRQHRAIVTEDNKVNGVTDSTRIMGYSFLYPSVIPCPYVQTVTLTPQDEFFIL
GSRGLWDAVSPAEAVEAVRNVPDGLAAAKKLCTLAQGYGCTDSLCAVVVQLSVSEDCCSC
CCSEPPQPPPSPGLGPYPPSSSERPSDGSLPVPPSSCSEISSEISTSEMSSEVGSTASSD
EPPQSSLVLLHEQPQHCCALHPACLAGSFQRQLSSATFSSALSDNGLDSEDEEPIAGVFS
NGSRVEVEADIHCLKAESAAASSPPCSPSPQTSQPSSSSQERTTPTLPPPPPPPCTPEPL
EEGIDTSPGEAKRRVNGSVARQEKSHNLIEVAAAAPSKKSGGYFTAPAQPDPDDQFIIPP
ELEEEVKEIMKQHQQKQQKPPATDQPTDYYDTPL
Download sequence
Identical sequences G3PHY2
ENSGACP00000017208 ENSGACP00000017208 69293.ENSGACP00000017208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]