SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017212 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017212
Domain Number 1 Region: 321-371
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000266
Family PHD domain 0.0071
Further Details:      
 
Domain Number 2 Region: 271-333
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000082
Family PHD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017212   Gene: ENSGACG00000013010   Transcript: ENSGACT00000017246
Sequence length 374
Comment pep:known_by_projection group:BROADS1:groupXVIII:15043658:15056340:1 gene:ENSGACG00000013010 transcript:ENSGACT00000017246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVIHNPLKSLGDQFYQEAIEHCRSYNARLCAERSVRMPFLDSQTGVAQNNCYIWMEKC
HRKPAGQAAGQMYTYPARCWRKKRRLHPPLDPQLRLCELRLEAELAPKREVPPGEATALE
ALLRGDSLLEKKTNICKEEETLLEIQRVLEAEENGDGLHDDEDFEQDTPKRKSRNRGKNR
GSSRRRSEPVNVEDQDKPFVCDNKYKQKHNSKKAEEVCGKRYKNRPGLSYHYTHTHLAEE
EGEDEKEAEMEPSPPFSVDNHKPQKAADGSIIPNDYCDFCLGDQEANRKTGQAEELVSCS
DCGRSGHPTCLQFTDNMMQAVRTYQWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYC
LKPPMTKPPEGSAA
Download sequence
Identical sequences G3PHY5
ENSGACP00000017212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]