SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017218 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017218
Domain Number 1 Region: 360-420
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.32e-17
Family PHD domain 0.0041
Further Details:      
 
Domain Number 2 Region: 309-370
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000377
Family PHD domain 0.031
Further Details:      
 
Domain Number 3 Region: 250-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000259
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017218   Gene: ENSGACG00000013010   Transcript: ENSGACT00000017252
Sequence length 430
Comment pep:known_by_projection group:BROADS1:groupXVIII:15043678:15056505:1 gene:ENSGACG00000013010 transcript:ENSGACT00000017252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVIHNPLKSLGDQFYQEAIEHCRSYNARLCAERSVRMPFLDSQTGVAQNNCYIWMEKC
HRKPAGQAAGQMYTYPARCWRKKRRLHPPLDPQLRLCELRLDSRSVLQHRSTLTGPQNVS
LMRSDSHTLCSSSSSSSEAELAPKREVPPGEATALEALLRGDSLLEKKTNICKEEETLLE
IQRVLEAEENGDGLHDDEDFEQDTPKRKSRNRGKKCARWWSSDDVVFSFQNRGSSRRRSE
PVNVEDQDKPFVCDICGKRYKNRPGLSYHYTHTHLAEEEGEDEKEAEMEPSPPFSVDNHK
PQKAADGSIIPNDYCDFCLGDQEANRKTGQAEELVSCSDCGRSGHPTCLQFTDNMMQAVR
TYQWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLKPPMTKPPEGSWSCHVCLDLL
KDKASAYGEA
Download sequence
Identical sequences G3PHZ1
ENSGACP00000017218 ENSGACP00000017218 69293.ENSGACP00000017218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]