SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017219 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017219
Domain Number 1 Region: 352-660
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.58e-116
Family Mammalian PLC 0.000000203
Further Details:      
 
Domain Number 2 Region: 192-351
Classification Level Classification E-value
Superfamily EF-hand 7.71e-39
Family EF-hand modules in multidomain proteins 0.015
Further Details:      
 
Domain Number 3 Region: 680-805
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.93e-29
Family PLC-like (P variant) 0.00023
Further Details:      
 
Domain Number 4 Region: 63-176
Classification Level Classification E-value
Superfamily PH domain-like 3.37e-26
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017219   Gene: ENSGACG00000013021   Transcript: ENSGACT00000017253
Sequence length 1052
Comment pep:known_by_projection group:BROADS1:groupXX:15304440:15317707:-1 gene:ENSGACG00000013021 transcript:ENSGACT00000017253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEGSRGEILTRMPGNAAGSRHNASNELPLRSRLLQDASRQRKERKKTVSFSSMPTEKKIS
SASDCIAAMVDGSELKKVRSNSRVYHRYFLLDADMQSLRWEPTKKESEKAKIDVKSIKEV
RTGKNTDTFRTNGTYDQISEDSAFSIIFGENYESLDLVANTADVANIWVTGLRYLISYGK
HTLNMIESTQNNMRSSWLGELFDEAGGNNSRKISLCAAVQLVKKLNPGLKNVKIELKFKE
LHKAKDKAGCDITKEEFIEVFHDLCTRPEIYFLFVQFSSNKEFLDTKDLMIFLEAEQGTA
QVSEDTSLEVIQKHEPSKEGQLKGWLSLDGFTNYLMSPECQLFDPEQKTVCQDMNQPMSH
YYINASHNTYLIEDQFRGPSDVTGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQI
VFRSVIDALNKYAFVASEFPLLLCLENHCSLQQQRVMFQHLKKILGDKIHVEPPKPEDCY
LPSPLALKGKILLKGKKLSTACTASEGEVTDEDEGAEMSQRMSIETAEPQTVAPKKFQLS
KDLSDLVTLCKSVEFKDFPTSFQSQKQWELCSFNEVFATRCASDFPGDFVNYNKKYLARV
YPSPMRIDSSNMNPQDFWKCGCQIVAMNYQTPGLMMDLNIGWFRQNGSCGYVLRPAIMRE
HVSYFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCG
EQRTKTVNQNGENPLFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQPG
FRHVPLQSLTGEVLPHTLLFVHVAITNRRGGGKPHKRGLSVRKGKRSREYASMRVLLIKA
VDDVFKTAMLPLREATDLRENMQNAIVSFKELCGLSAVANLKQCILALSPRLTGTDNSPL
LVFNLADQYPNLEPQGLLPEVLKKVVTTYETVIQTSKTLLESYEGVYERILQTQKAAMAF
HENIHDSAVKEGLKGRKLHKAVESFTWNITILKGQLDLLKHARNEVQENLKQIHYAALTS
NLSKGGPPGGPESKSRRSLEAIPEKATAEEEL
Download sequence
Identical sequences G3PHZ2
ENSGACP00000017219 ENSGACP00000017219 69293.ENSGACP00000017219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]